2. Search Result
Search Result
Results for "

Cys12

" in MedChemExpress (MCE) Product Catalog:

138

Inhibitors & Agonists

148

Peptides

4

Natural
Products

3

Isotope-Labeled Compounds

1

Click Chemistry

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-145928
    Divarasib
    5+ Cited Publications

    GDC-6036

    		 Ras Cancer
    Divarasib (GDC-6036) is an orally active, selective KRAS G12C inhibitor with an IC50 of <0.01 μM. Divarasib covalently binds Cys12 in GDP-bound KRAS G12C, occupies the switch II pocket, blocks GTP binding and SOS-mediated reactivation, and inhibits oncogenic KRAS signaling. Divarasib induces tumor shrinkage and robust tumor growth inhibition in KRAS G12C-positive models and cancer cells. Divarasib can be used for the research of non-small cell lung cancer, colorectal adenocarcinoma, pancreatic ductal adenocarcinoma, and other KRAS G12C-mutated solid tumors .
    Divarasib
  • HY-P0090
    Calcitonin (salmon)
    2 Publications Verification

    Salmon calcitonin

    		 CGRP Receptor Cancer
    Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
    Calcitonin (salmon)
  • HY-B1811
    Vasopressin
    5+ Cited Publications

    Arginine vasopressin; Antidiuretic hormone

    		 Endogenous Metabolite Neurological Disease
    Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
    Vasopressin
  • HY-P0202
    Endothelin 1 (swine, human)
    5+ Cited Publications

    ET-1 (swine, human)

    		 Endothelin Receptor Metabolic Disease Inflammation/Immunology
    Endothelin 1 (swine, human) (ET-1) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
    Endothelin 1 (swine, human)
  • HY-P0049
    Argipressin
    Maximum Cited Publications
    10 Publications Verification

    Arg8-vasopressin; AVP

    		 Vasopressin Receptor Neurological Disease Cancer
    Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
    Argipressin
  • HY-P0256
    Apamin
    Maximum Cited Publications
    10 Publications Verification

    Apamine

    		 Potassium Channel Neurological Disease Inflammation/Immunology
    Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
    Apamin
  • HY-P1036
    Compstatin
    3 Publications Verification

    		 Complement System Others
    Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
    Compstatin
  • HY-P4860
    Adropin (34-76) (human, mouse, rat)
    1 Publications Verification

    		 Akt Gli JNK PKA Metabolic Disease
    Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
    Adropin (34-76) (human, mouse, rat)
  • HY-P5322
    Thrombospondin (TSP-1)-derived CD36 binding motif

    		Transmembrane Glycoprotein Cardiovascular Disease Cancer
    Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
    Thrombospondin (TSP-1)-derived CD36 binding motif
  • HY-W539944
    Argipressin acetate
    Maximum Cited Publications
    10 Publications Verification

    Arg8-vasopressin acetate; AVP acetate

    		 Vasopressin Receptor Apoptosis Neurological Disease Cancer
    Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
    Argipressin acetate
  • HY-P3448
    Certepetide

    CEND-1; iRGD; LSTA1

    		 Integrin Complement System Cancer
    Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
    Certepetide
  • HY-P3226
    JB-1

    		IGF-1R VEGFR Drug Derivative Cardiovascular Disease Neurological Disease
    JB-1, an IGF-I analog, is a selective IGF-I receptor inhibitor that does not interact with IGF-II. JB-1 competes with IGF-I for binding to IGF-1R and blocks receptor autophosphorylation. JB-1 increases the level of sVEGFR-1. JB-1 normalizes retinal abnormalities, including reducing retinal neovascularization. JB-1 is applicable to studies related to oxygen-induced retinopathy .
    JB-1
  • HY-P2315
    Human β-defensin-1

    HβD-1

    		 Antibiotic Bacterial Infection
    Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
    Human β-defensin-1
  • HY-171910
    tri(GalNAc-PEG2)-PEG4-cyclo(Ac-DCAW-{Arg(3F-Ph)-PEG2}-LGELVWCT) (Cys2-Cys12)

    		Asialoglycoprotein Receptor (ASGPR) LYTACs Others
    tri(GalNAc-PEG2)-PEG4-cyclo(Ac-DCAW-{Arg(3F-Ph)-PEG2}-LGELVWCT) (Cys2-Cys12) is an asialoglycoprotein receptor (ASGPR) ligand that can be used for LYsosome TArgeting Chimera (LYTAC) research .
    tri(GalNAc-PEG2)-PEG4-cyclo(Ac-DCAW-{Arg(3F-Ph)-PEG2}-LGELVWCT) (Cys2-Cys12)
  • HY-P2526
    LyP-1
    2 Publications Verification

    		 Complement System Cancer
    LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
    LyP-1
  • HY-A0182A
    Felypressin acetate
    3 Publications Verification

    PLV-2 acetate

    		 Vasopressin Receptor Cardiovascular Disease
    Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
    Felypressin acetate
  • HY-A0182
    Felypressin
    3 Publications Verification

    PLV-2

    		 Vasopressin Receptor Cardiovascular Disease
    Felypressin (PLV-2) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin is widely used in dental procedures .
    Felypressin
  • HY-P0004
    Lysipressin
    2 Publications Verification

    Lysine vasopressin; [Lys8]-Vasopressin

    		 Adenylate Cyclase Oxytocin Receptor Cardiovascular Disease Neurological Disease
    Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs. Lysipressin activates Oxytocin receptors and adenylate-cyclase. Lysipressin adjusts blood pressure and heart rate. Lysipressin shows antinociceptive activity .
    Lysipressin
  • HY-P0204
    Endothelin-3, human, mouse, rabbit, rat
    1 Publications Verification

    Endothelin 3 (Rat,Human)

    		 Endothelin Receptor Integrin Neurological Disease
    Endothelin-3, human, mouse, rabbit, rat (Endothelin 3 (Rat,Human)) is an adhesion stimulant. Endothelin-3, human, mouse, rabbit, rat stimulates the adhesion of enteric neural crest cells to various ECM components. Endothelin-3, human, mouse, rabbit, rat plays an important role in the maintenance and self-renewal of intestinal progenitor cells, participates in the migration of enteric neural crest cells, and helps maintain a suitable environment for the colonization of enteric neural crest cells. Endothelin-3, human, mouse, rabbit, rat acts synergistically with the β1-integrin signaling pathway during enteric nervous system development. Endothelin-3, human, mouse, rabbit, rat can be used in studies related to distal aganglionosis .
    Endothelin-3, human, mouse, rabbit, rat
  • HY-P1632
    Tachyplesin I

    		Bacterial Infection Cancer
    Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
    Tachyplesin I
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-145928B
    Divarasib adipate
    5+ Cited Publications

    GDC-6036 adipate

    		 Ras Cancer
    Divarasib (GDC-6036) adipate is an orally active, selective KRASG12C inhibitor with an IC50 of <0.01 μM. Divarasib adipate covalently binds Cys12 in GDP-bound KRASG12C, occupies the switch II pocket, blocks GTP binding and SOS-mediated reactivation, and inhibits oncogenic KRAS signaling. Divarasib adipate induces tumor shrinkage and robust tumor growth inhibition in KRASG12C-positive models and cancer cells. Divarasib adipate can be used for the research of non-small cell lung cancer, colorectal adenocarcinoma, pancreatic ductal adenocarcinoma, and other KRASG12C-mutated solid tumors .
    Divarasib adipate
  • HY-P0202A
    Endothelin 1 (swine, human) TFA
    5+ Cited Publications

    ET-1 (swine, human) TFA

    		 Endothelin Receptor Cardiovascular Disease
    Endothelin 1 (swine, human) (ET-1) TFA is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 TFA acts through two types of receptors ETA and ETB .
    Endothelin 1 (swine, human) TFA
  • HY-P3512
    Iseganan

    IB-367

    		 Bacterial Fungal Parasite Infection Cancer
    Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
    Iseganan
  • HY-P1036A
    Compstatin TFA
    3 Publications Verification

    		 Complement System Others
    Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
    Compstatin TFA
  • HY-P5533
    CRT

    		Biochemical Assay Reagents Cancer
    CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
    CRT
  • HY-P10557
    DAG peptide

    		Biochemical Assay Reagents Neurological Disease
    DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
    DAG peptide
  • HY-P10235
    Cyclic AC253

    		Amylin Receptor Neurological Disease
    Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
    Cyclic AC253
  • HY-P4990A
    Pro8-Oxytocin TFA

    		Oxytocin Receptor Endocrinology
    Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
    Pro8-Oxytocin TFA
  • HY-P4605
    (Ile8)-Oxytocin

    Mesotocin

    		 Endogenous Metabolite Metabolic Disease
    (Ile8)-Oxytocin is a neurohypophysial hormone mesotocin produced in marsupials .
    (Ile8)-Oxytocin
  • HY-P4990
    Pro8-Oxytocin

    		Oxytocin Receptor Endocrinology
    Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
    Pro8-Oxytocin
  • HY-P0207
    Endothelin-2 (49-69), human

    Endothelin-2 (human, canine); Human endothelin-2

    		 Endothelin Receptor Cardiovascular Disease Cancer
    Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
    Endothelin-2 (49-69), human
  • HY-P2538
    Big Endothelin-1 (1-38), human

    		Vasopressin Receptor Cardiovascular Disease
    Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide .
    Big Endothelin-1 (1-38), human
  • HY-P3071
    ShK toxin

    Stichodactyla helianthus neurotoxin

    		 Potassium Channel Neurological Disease Inflammation/Immunology
    ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
    ShK toxin
  • HY-P11071
    PCSK9 Inhibitor, EGF-A

    		PCSK9 Cardiovascular Disease
    PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
    PCSK9 Inhibitor, EGF-A
  • HY-17571F
    Biotin-Oxytocin

    Biotin-α-Hypophamine; Biotin-Oxytocic hormone

    		 Oxytocin Receptor Others
    Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
    Biotin-Oxytocin
  • HY-P5917A
    Vm24-toxin TFA

    Vaejovis mexicanus peptide 24 TFA

    		 Potassium Channel Inflammation/Immunology Cancer
    Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
    Vm24-toxin TFA
  • HY-P1789A
    CTTHWGFTLC, CYCLIC TFA

    		MMP Inflammation/Immunology Cancer
    CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
    CTTHWGFTLC, CYCLIC TFA
  • HY-P11354
    THR-123

    		TGF-β Receptor Apoptosis Interleukin Related Integrin Cadherin Inflammation/Immunology
    THR-123 is an orally active ALK3 peptide agonist. THR-123 has a relatively weak binding to ALK2, but does not bind to ALK6. THR-123 suppresses inflammation, apoptosis and the epithelial-to-mesenchymal transition program and reverses established fibrosis in five mouse models of acute and chronic renal injury. THR-123 can be used for the study of kidney fibrosis .
    THR-123
  • HY-P4605A
    (Ile8)-Oxytocin acetate

    		Endogenous Metabolite Metabolic Disease
    (Ile8)-Oxytocin acetate is a neurohypophysial hormone interoxitocin produced in marsupials .
    (Ile8)-Oxytocin acetate
  • HY-P0049A
    Argipressin diacetate

    Arg8-vasopressin diacetate; AVP diacetate; ADH

    		 Apoptosis Vasopressin Receptor Neurological Disease Cancer
    Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
    Argipressin diacetate
  • HY-P3953
    Wy 41747

    		Somatostatin Receptor Metabolic Disease
    Wy 41747 is a long-acting Somatostatin analogue. Wy 41747 can be used for the research of diabetes mellitus .
    Wy 41747
  • HY-P10383
    SPSB2-iNOS inhibitory cyclic peptide-1

    		NO Synthase Infection
    SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
    SPSB2-iNOS inhibitory cyclic peptide-1
  • HY-P3563
    [Lys4] Sarafotoxin S6c

    		Endothelin Receptor Cardiovascular Disease
    [Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
    [Lys4] Sarafotoxin S6c
  • HY-P10320
    T3 Peptide

    Tumstatin (69-88), human

    		 PI3K Akt Cardiovascular Disease
    T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
    T3 Peptide
  • HY-P5642
    Retrocyclin-101

    RC-101

    		 Bacterial Ser/Thr Protease Influenza Virus HSV SARS-CoV Toll-like Receptor (TLR) Fungal HIV Flavivirus Infection Inflammation/Immunology
    Retrocyclin-101 (RC-101) is a synthetic cyclic θ-defensin, a broad-spectrum antimicrobial peptide with anti-pathogen (covering viruses, bacteria and fungi) activity and anti-inflammatory activity. Retrocyclin-101 exhibits significant inhibitory activity against HIV, SARS-CoV-2, flaviviruses, influenza viruses, HSV-1/2, Staphylococcus aureus and others. Retrocyclin-101 inhibits TLR4 and TLR2-mediated signal transduction and reduces pro-inflammatory cytokine expression .
    Retrocyclin-101
  • HY-161096
    Antitumor agent-127

    		ROR Cancer
    Antitumor agent-127 (compound 1) is a parent macrocyclic peptide. Antitumor agent-127 displays nanomolar cell-based binding to ROR1 and relatively good internalization in 786-O and MDA-MB-231 tumor cell lines .
    Antitumor agent-127
  • HY-P3071A
    ShK toxin TFA

    Stichodactyla helianthus neurotoxin TFA

    		 Potassium Channel Neurological Disease Inflammation/Immunology
    ShK toxin TFA (Stichodactyla helianthus neurotoxin TFA) is a neurotoxin. ShK toxin TFA blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin TFA can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin TFA competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin TFA suppresses K + currents in cultured rat dorsal root ganglion neurons. ShK toxin TFA also inhibits T lymphocyte proliferation .
    ShK toxin TFA
  • HY-170649
    RdRP-IN-9

    		SARS-CoV Infection
    RdRP-IN-9 (Compound 6b) is a reversible covalent allosteric inhibitor of RdRp. RdRP-IN-9 demonstrates high anti-coronavirus activity, with an EC50 value of 0.68 μM against HCoV-OC43 RdRP-IN-9 exerts a more prolonged antiviral effect by reversibly acylating Cys12 in the NiRAN domain of non-structural protein 12 (nsp 12) and exhibits synergistic anti-coronavirus activity with Molnupiravir (HY-135853) .
    RdRP-IN-9
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: