TAT-M2NX
Based on 1 Customer Validation
TAT-M2NX (tatM2NX) is a selective inhibitor targeting human TRPM2 channels and exerts inhibitory effects on ischemic stroke. TAT-M2NX reduces H2O2-induced calcium influx via TRPM2 channels. After traumatic brain injury in mice, TAT-M2NX preserves hippocampal long-term potentiation, improves memory function, and reduces infarct volume after middle cerebral artery occlusion, but it shows no effect on female mice. TAT-M2NX can be used in studies related to traumatic brain injury and ischemic stroke.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 99.55%
- CAS. Nr.: 2126166-03-6
- Formel: C190H323N71O45S
- Molecular Weight:4354.11
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
|
TRPM2 |
TAT-M2NX (20 mg/kg; retro-orbital injection; single administration) exerts cerebral ischemia-specific neuroprotective effects in male mice: when administered prior to middle cerebral artery occlusion (MCAO), it reduces infarct volume[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:C57Bl/6 (adult 2-4 month, male)[1]
-
Dosage:0.2 mg/kg; 2 mg/kg; 10 mg/kg; 20 mg/kg
-
Administration:i.v.; single dose at 2 hours post-TBI
-
Result:Did not affect hippocampal LTP, with a normalized fEPSP slope of 129.9%, which was not significantly different from control-treated TBI mice.
Preserved hippocampal LTP, with a normalized fEPSP slope of 165.5%, and prevented TBI-induced memory impairment, with freezing behavior of 47.9%.
Preserved hippocampal LTP, with a normalized fEPSP slope of 186.9%, and prevented TBI-induced memory impairment, with freezing behavior of 52.1%.
Prevented TBI-induced memory impairment, with freezing behavior of 62.3%, which was equivalent to the effect of 10 mg/kg.
-
Animal Model:C57Bl/6 (young adult, 2-3 month old, male, wild-type; TRPM2−/− (young adult, 2-3 month old, male, knockout))[2]
-
Dosage:20 mg/kg
-
Administration:retro-orbital; single dose (20 min prior to MCAO; 3 h after reperfusion)
-
Result:Reduced mean infarct volume to 29.2% in wild-type mice treated 20 min prior to MCAO. Reduced mean infarct volume to 28.3% (24 h post-reperfusion) and 23.8% (96 h post-reperfusion) in wild-type mice treated 3 h after reperfusion. Showed no further reduction in infarct volume (27.3%) in TRPM2−/− knockout mice compared to untreated TRPM2−/− knockout mice (27.3%).
Chemical Information
-
CAS. Nr. 2126166-03-6
-
Appearance Solid
-
Molecular Weight 4354.11
-
Formel C190H323N71O45S
-
Color White to off-white
-
Synonyms
tatM2NX
-
Sequence
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val
-
Sequence Shortening
YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
H2O : 50 mg/mL (11.48 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (272 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Orfila JE, et al. A novel peptide inhibitor of TRPM2 channels improves recovery of memory function following traumatic brain injury. Front Synaptic Neurosci. 2025;17:1534379. Published 2025 Apr 25. [Content Brief]
[2]. Shimizu T, et al. Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia. Exp Neurol. 2016;283(Pt A):151-156. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2297 mL | 1.1483 mL | 2.2967 mL | 5.7417 mL |
| 5 mM | 0.0459 mL | 0.2297 mL | 0.4593 mL | 1.1483 mL | |
| 10 mM | 0.0230 mL | 0.1148 mL | 0.2297 mL | 0.5742 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
TAT-M2NX Related Classifications
HY-P5883 Related Classifications
Powered by Bioz