BMAP-28
BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer.
For research use only. We do not sell to patients.
- CAS No.: 184870-31-3
- Formula: C145H250N44O29
- Molecular Weight:3073.81
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
All Antibiotic Isoforms
More
Biological Activity
BMAP-28 (3 µM; 10 min) attenuates mitochondrial calcein fluorescence in U937 cells[1].
BMAP-28 causes depolarization of the inner mitochondrial membrane in single cells and in isolated mitochondria[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:U937 cells
-
Concentration:3 µM
-
Incubation Time:10 min
-
Result:Caused a remarkable attenuation of the calcein fluorescence.
Chemical Information
-
CAS No. 184870-31-3
-
Molecular Weight 3073.81
-
Formula C145H250N44O29
-
Sequence
Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2
-
Sequence Shortening
GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
BMAP-28 Related Classifications
HY-P5288 Related Classifications
Powered by Bioz