GCGR
Glucagon Receptor
All Product Categories
-
GCGR Related Products (196)
Related Products (196)
-
Recombinant Proteins (15)
-
Antibodies (3)
-
(Ser8)-GLP-1 (7-36) amide, human
0 Images(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
NN1177 TFA
0 ImagesCat. No.: HY-P10032APurity: 99.22%Synonyms: NNC9204-1177 TFANN1177 (NNC9204-1177) TFA is a long-acting GLP-1/glucagon receptor co-agonist. NN1177 TFA can induce a dose-dependent body weight loss in diet-induced obese (DIO) mice. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- GLP-1 (1-36) amide (human, rat) TFA
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- GLP-1R modulator C16
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
GIP/GLP-1 dual receptor agonist-1 sodium
0 ImagesCat. No.: HY-153476APurity: 98.33%GIP/GLP-1 dual receptor agonist-1 sodium is a GIP/GLP-1 dual receptor agonist. GIP/GLP-1 dual receptor agonist-1 sodium is used in the research of metabolic disorders and fatty liver diseases, including non-alcoholic steatohepatitis (NASH) and non-alcoholic fatty liver disease (NAFLD). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Pegloxenatide
0 ImagesCat. No.: HY-P3491CAS No.: 2420483-82-3Synonyms: Polyethylene glycol loxenatide; PEX 168Pegloxenatide (Polyethylene glycol loxenatide) is a long-acting glucagon-like peptide-1 receptor (GLP-1RA) agonist. Pegloxenatide has various activities such as lowering blood glucose, lowering blood lipids, improving body weight, anti-inflammation, promoting wound healing, protecting the liver, and protecting the heart. Pegloxenatide can be used in the research of type 2 diabetes and its multiple complications. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
GPCR modulator-1
0 ImagesCat. No.: HY-124803CAS No.: 1407592-99-7GPCR modulator-1 is a negative allosteric modulator of the GLP-1 receptor (GLP-1R). GPCR modulator-1 can be used for the study of type 2 diabetes. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Skyrin
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Retatrutide acetate
0 ImagesCat. No.: HY-P3506BPurity: 99.69%Synonyms: LY3437943 acetateRetatrutide (LY3437943) acetate is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide acetate inhibits human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide acetate can be used for the research of obesity. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
[Gly8]-GLP-1(7-37) acetate
0 ImagesCat. No.: HY-108795BPurity: 98.10%[Gly8]-GLP-1(7-37) acetate is a derivative of GLP-1 containing alanine-to-glycine substitution at positions 8. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Exendin-3
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Survodutide sodium
0 ImagesCat. No.: HY-P4146BPurity: 99.10%Synonyms: BI 456906 sodiumSurvodutide (BI 456906) sodium is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide sodium, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide sodium has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- HAEGTFT
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Anti-GLP1R Antibody
0 ImagesCat. No.: HY-P991099 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Elsiglutide
0 ImagesSynonyms: ZP1846 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Exendin (5-39)
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- HAEGTFTSD
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
VU0453379 hydrochloride
0 ImagesCat. No.: HY-116819APurity: 99.0%VU0453379 hydrochloride is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
[Des-His1,Glu9]-Glucagon amide
0 Images[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results