Cecropin B
Based on 1 publication(s) in Google Scholar
Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98.05%
- CAS. Nr.: 80451-05-4
- Formel: C176H302N52O41S
- Molecular Weight:3834.67
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Protokoll
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Cecropin B
More
Customer Validation & Images
-
RT-PCR
Alle Antibiotic Isoform-spezifische Produkte anzeigen
More
Biologische Aktivität
|
CYP3 |
Cecropin B-induces NF-κB activation playing a pivotal role in the suppression of CYP3A29 through disrupting the association of the PXR/retinoid X receptor alpha (RXR-α) complex with DNA sequences. Cecropin B activates pig liver cells by interacting with TLRs 2 and 4, which modulated NF-κB-mediated signaling pathways[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 80451-05-4
-
Appearance Solid
-
Molecular Weight 3834.67
-
Formel C176H302N52O41S
-
Color White to off-white
-
Sequence
Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
-
Sequence Shortening
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
PeerJ
A novel cecropin B-derived peptide with antibacterial and potential anti-inflammatory properties. [Abstract]2018 Jul 25:6:e5369. PMID: 30065898
Cecropin B purchased from MedChemExpress. Usage Cited in: PeerJ. 2018 Jul 25:6:e5369. [Abstract]
Effects of Cecropin B and Cecropin DH on mRNA levels of inflammatory cytokines in 200 ng/mL LPS-stimulated RAW264.7 cells. Total RNA is analyzed for the expression of TNF-α, IL-1β, iNOS, MIP-1, MIP-2, IL-6 and GAPDH (loading control) by RT-PCR.
Lösungsmittel & Löslichkeit
H2O : 100 mg/mL (26.08 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Protokoll
Mice[1]
Thirty ICR mice are enrolled in the study, and the Pseudomonas aeruginosa infection model is reproduced by excision of the full layer of dorsal skin with an area of 1 cm x 1 cm. Then they are randomly divided into C (control, n=10, with wet compress of isotonic saline at 3 postinjury hour (PIH)) , M (with hydropathic compress of 100 g/L mafenide at 3 PIH), A (with wet compress of 1 000 mg/L Cecropin B at 3 PIH) groups. The changes in body temperature and hemogram in each group are determined before and 4 days after injury[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Reinheit & Dokumentation
-
Data Sheet (272 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Zhou X et al. Cecropin B Represses CYP3A29 Expression through Activation of the TLR2/4-NF-κB/PXR Signaling Pathway. Sci Rep. 2016 Jun 14 [Content Brief]
[2]. Ren HT et al. [The antibacterial effect of cecropin B on pseudomonas aeruginosa infection of wounds in mice]. Zhonghua Shao Shang Za Zhi. 2006 Dec;22(6):445-7. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2608 mL | 1.3039 mL | 2.6078 mL | 6.5195 mL |
| 5 mM | 0.0522 mL | 0.2608 mL | 0.5216 mL | 1.3039 mL | |
| 10 mM | 0.0261 mL | 0.1304 mL | 0.2608 mL | 0.6519 mL | |
| 15 mM | 0.0174 mL | 0.0869 mL | 0.1739 mL | 0.4346 mL | |
| 20 mM | 0.0130 mL | 0.0652 mL | 0.1304 mL | 0.3260 mL | |
| 25 mM | 0.0104 mL | 0.0522 mL | 0.1043 mL | 0.2608 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Cecropin B Related Classifications
HY-P0092 Related Classifications
Powered by Bioz