Search Result

Results for "

ACE

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin-converting Enzyme (ACE) (159) 11β-HSD (3) AAK1 (1) Akt (1) Angiotensin Receptor (10) Apoptosis (17) Autophagy (9) Bacterial (3) Biochemical Assay Reagents (1) Bradykinin Receptor (1) Carbonic Anhydrase (1) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (2) Drug Metabolite (9) Endogenous Metabolite (14) FXR (1) Glucocorticoid Receptor (6) HBV (1) HDAC (1) IKK (1) Influenza Virus (1) Interleukin Related (1) Isotope-Labeled Compounds (15) mAChR (2) MMP (4) Neprilysin (5) NF-κB (1) Opioid Receptor (1) Parasite (1) PKC (1) Pyroptosis (1) Reactive Oxygen Species (2) Renin (1) SARS-CoV (25) Small Interfering RNA (siRNA) (8) TGF-beta/Smad (1) TGF-β Receptor (2) TNF Receptor (1) Toll-like Receptor (TLR) (1) VEGFR (1) Xanthine Oxidase (1)
By Research Areas:	Cancer (27) Cardiovascular Disease (126) Endocrinology (15) Infection (26) Inflammation/Immunology (31) Metabolic Disease (24) Neurological Disease (8)

By Targets:

Angiotensin-converting Enzyme (ACE) (159)

11β-HSD (3)

AAK1 (1)

Akt (1)

Angiotensin Receptor (10)

Apoptosis (17)

Autophagy (9)

Bacterial (3)

Biochemical Assay Reagents (1)

Bradykinin Receptor (1)

Carbonic Anhydrase (1)

Casein Kinase (3)

Caspase (2)

CDK (1)

Cholinesterase (ChE) (2)

Drug Metabolite (9)

Endogenous Metabolite (14)

FXR (1)

Glucocorticoid Receptor (6)

HBV (1)

HDAC (1)

IKK (1)

Influenza Virus (1)

Interleukin Related (1)

Isotope-Labeled Compounds (15)

mAChR (2)

MMP (4)

Neprilysin (5)

NF-κB (1)

Opioid Receptor (1)

Parasite (1)

PKC (1)

Pyroptosis (1)

Reactive Oxygen Species (2)

Renin (1)

SARS-CoV (25)

Small Interfering RNA (siRNA) (8)

TGF-beta/Smad (1)

TGF-β Receptor (2)

TNF Receptor (1)

Toll-like Receptor (TLR) (1)

VEGFR (1)

Xanthine Oxidase (1)

By Research Areas:

Cancer (27)

Cardiovascular Disease (126)

Endocrinology (15)

Infection (26)

Inflammation/Immunology (31)

Metabolic Disease (24)

Neurological Disease (8)

221

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Sotatercept ACE-011	TGF-β Receptor	Inflammation/Immunology Cancer
Sotatercept (ACE-011) is a soluble activin receptor 2A (ACVR2A) type IgG Fc fusion protein. Sotatercept combines activin and growth differentiation factor to try to restore the balance between growth promotion and growth inhibition signal pathways. Sotatercept has potential application in pulmonary arterial hypertension, anemia, bone loss, erythropoiesis, multiple myeloma (MM) osteolytic lesions .

Ramatercept ACE-031	TGF-β Receptor	Metabolic Disease
Ramatercept (ACE-031) is a soluble ActRIIB receptor and can be used as a soluble activin receptor 2 (ACVR2) antagonist. Ramatercept inhibits the signal pathway of muscle growth inhibition and has potential application in muscle atrophy .

ACE Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
ACE Human Pre-designed siRNA Set A contains three designed siRNAs for ACE gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

Ace Mouse Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
Ace Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ace gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

ACE Rat Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
ACE Rat Pre-designed siRNA Set A contains three designed siRNAs for ACE gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

Luspatercept ACE-536; luspatercept–aamt	TGF-beta/Smad	Metabolic Disease
Luspatercept (ACE-536) is a recombinant modified ActRIIB fusion protein that binds with transforming growth factor β superfamily ligands. Luspatercept increases the erythrocyte numbers and promotes maturation of erythroid precursors. Luspatercept binds with GDF11 and inhibits Smad2/3 signaling. Luspatercept can be used for the research of anemia .

ACE2 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

ACE2 Rat Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Metabolic Disease
ACE2 Rat Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

ACES N-(2-ACEtamido)-2-aminoethanesulfonic acid	Biochemical Assay Reagents	Others
ACES (N-(2-Acetamido)-2-aminoethanesulfonic acid) is a zwitterionic buffer. The working pH range of ACES buffer is 6.8-7.2 .

ACER1 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
ACER1 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

ACER2 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
ACER2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

ACER3 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
ACER3 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER3 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

Acerogenin G	Others	Others
Acerogenin G is a synthetic diarylheptane. Acerogenin G is first isolated from Acer nikoense .

Acetyl tetrapeptide-5	Angiotensin-converting Enzyme (ACE)	Others
Acetyl tetrapeptide-5 inhibits glycosylation and *ACE-1* activity. Acetyl tetrapeptide-5 reduces edema and relieves vascular pressure by improving the vascular system and strengthening the skin under the eyes. Acetyl tetrapeptide-5 can be used in the research of Antioxidant, anti-aging skin care .

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Teprotide is an inhibitor of angiotensin-converting enzyme (ACE) inhibitor. Teprotide can be used to study hypertensive .

Perindopril acyl-β-D-glucuronide	Drug Metabolite	Cardiovascular Disease
Perindopril acyl-β-D-glucuronide is a metabolite of Perindopril (HY-B0130). Perindopril is an ACE inhibitor .

Enalapril MK-421	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

Trandolaprilate-d5 Trandolaprilat d₅; RU 44403 d₅	Isotope-Labeled Compounds Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

Enalapril sodium MK-421 sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalapril (MK-421) sodium is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

Delapril CV-3317	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril (CV-3317) is an orally active angiotensin I converting enzyme (ACE) inhibitor. Delapril has antihypertensive activity .

Camellianin B	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities .

Fosinopril SQ28555 free acid	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril (SQ28555 free acid) is the ester proagent of angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on *ACE* activity with an K_i value of 1.675 μM .

Spirapril hydrochloride SCH 33844 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure .

(R)-MLN-4760	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
(R)-MLN-4760, the R-enantiomer of MLN-4760, is an *ACE2* inhibitor, with an IC₅₀ of 8.4 μM. (R)-MLN-4760 is the less active isomer .

Fosinopril sodium 1 Publications Verification SQ28555	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

5-O-beta-D-Glucopyranosylmyricanol	Others	Others
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

GF109	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
GF109 is a potent parenteral inhibitor of angiotensin converting enzyme (ACE). GF109 has antihypertensive effects .

Vasicinol 6-Hydroxypeganine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vasicinol is a reversible inhibitor of sucrase (IC₅₀: 250 μM). Vasicinol is a HbF inducer. Vasicinol also inhibits Angiotensin-converting Enzyme (ACE). Vasicinol is apyrroquinazoline alkaloid that can be isolated from Adhatoda vasica .

Fosinopril sodium (Standard)	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril (sodium) (Standard) is the analytical standard of Fosinopril (sodium). This product is intended for research and analytical applications. Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

Perindoprilat S 9780	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

Libenzapril Abutapril; CGS-16617	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Endocrinology
Libenzapril (Abutapril; CGS-16617) is an orally active, potent direct-acting angiotensin-converting-enzyme (ACE) inhibitor. Libenzapril has the potential for ischemia-induced heart failure research .

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of Angiotensin-converting enzyme (ACE, HY-P2983) .

N-Benzoyl-Gly-His-Leu hydrate	Angiotensin-converting Enzyme (ACE)
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.

NH2-AKK-COOH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NH2-AKK-COOH, a synthetic tripeptide, is an *ACE* inhibitor, with IC₅₀s of 0.090 μM, 0.178 μM, and 420.89 μM when FAPGG, HHL, and angiotensin-I are used as substrate respectively .

Quinaprilat hydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinaprilat hydrate is a non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat hydrate specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat hydrate acts as anti-hypertensive agent and vasodilator .

Quinaprilat	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinaprilat is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat acts as anti-hypertensive agent and vasodilator .

Quinaprilat hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinaprilat hydrochloride is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat hydrochloride specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat hydrochloride acts as anti-hypertensive agent and vasodilator .

AD011	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
AD011 is a dual inhibitor of cACE/NEP. AD011 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD011 has the potential for providing the potent antihypertensive and cardioprotective benefits .

AD012	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
AD012 is a dual inhibitor of cACE/NEP. AD012 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD012 has the potential for providing the potent antihypertensive and cardioprotective benefits .

AD013	Angiotensin-converting Enzyme (ACE)	Others
AD013 is a dual inhibitor of cACE/NEP. AD013 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD013 has the potential for providing the potent antihypertensive and cardioprotective benefits .

Ramiprilat HOE 498 diacid; Ramipril diacid	Drug Metabolite Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

Indolapril hydrochloride CI-907	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Indolapril hydrochloride (CI-907) is an orally active nonsulfhydryl angiotensin converting enzyme (ACE) inhibitor. Indolapril hydrochloride is highly specific in suppressing the contractile or pressor responses to Angiotensin I. Indolapril hydrochloride is a potent antihypertensive agent .

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1,481 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,481 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Type

HY-P2536

Mca-Ala-Pro-Lys(Dnp)-OH	Fluorescent Dyes/Probes
Mca-Ala-Pro-Lys(Dnp)-OH, a specific ACE2 quenched fluorogenic substrate, can be used to detect ACE2 activity, such as urinary, heart and lung .

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Chromogenic Substrates Amino acids and Derivatives
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination .

HY-D1270

Direct Violet 1	Dyes
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and *ACE2* inhibitor with IC₅₀s of 1.47-2.63 μM .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH

Chromogenic Substrates

Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Cat. No.	Product Name	Target	Research Area

HY-P0095

Acetyl tetrapeptide-5	Angiotensin-converting Enzyme (ACE)	Others
Acetyl tetrapeptide-5 inhibits glycosylation and *ACE-1* activity. Acetyl tetrapeptide-5 reduces edema and relieves vascular pressure by improving the vascular system and strengthening the skin under the eyes. Acetyl tetrapeptide-5 can be used in the research of Antioxidant, anti-aging skin care .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Teprotide is an inhibitor of angiotensin-converting enzyme (ACE) inhibitor. Teprotide can be used to study hypertensive .

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P2072

GF109

Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

GF109 is a potent parenteral inhibitor of angiotensin converting enzyme (ACE). GF109 has antihypertensive effects .

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of Angiotensin-converting enzyme (ACE, HY-P2983) .

HY-137875

N-Benzoyl-Gly-His-Leu hydrate	Angiotensin-converting Enzyme (ACE)
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.

HY-P3424

NH2-AKK-COOH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NH2-AKK-COOH, a synthetic tripeptide, is an *ACE* inhibitor, with IC₅₀s of 0.090 μM, 0.178 μM, and 420.89 μM when FAPGG, HHL, and angiotensin-I are used as substrate respectively .

HY-P10173

Abz-LFK(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P2605

Tuna AI	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Tuna AI, an angiotensin-converting enzyme (ACE) inhibitor, exhibits IC₅₀ values of 1 μM and 2 μM for ACEs from bovine and rabbit lungs, respectively .

HY-P2536

Mca-Ala-Pro-Lys(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Mca-Ala-Pro-Lys(Dnp)-OH, a specific ACE2 quenched fluorogenic substrate, can be used to detect ACE2 activity, such as urinary, heart and lung .

HY-P2222

DX600	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
DX600 is a selective *ACE2* specific inhibitor (K_D: 1.3 nM), and does not cross-react with ACE. DX600 exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity .

HY-P2222A

DX600 TFA 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
DX600 TFA is a selective *ACE2* specific inhibitor (K_D: 1.3 nM), and does not cross-react with ACE. DX600 TFA exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity .

HY-P4471

p-Hydroxyhippuryl-His-Leu

Angiotensin-converting Enzyme (ACE) Others

p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .
HY-P4420

H-Lys-Trp-OH

Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

H-Lys-Trp-OH (KW) is an ACE inhibitory peptide with an IC₅₀ of 7.8 μM .

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-P4552

Hippuryl-Phe-Arg-OH

Peptides Others

Hippuryl-Phe-Arg-OH is the active site on the cell surface of Angiotensin I converting enzyme (ACE) .

HY-P1032

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P0266

N-Acetyl-Ser-Asp-Lys-Pro Ac-SDKP	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro, an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH

Caspase Angiotensin-converting Enzyme (ACE) Others

Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .
HY-P4546

Abz-Ser-Pro-3-nitro-Tyr

Angiotensin-converting Enzyme (ACE) Others

Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P0266A

N-Acetyl-Ser-Asp-Lys-Pro TFA Ac-SDKP TFA	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-P2616A

Mca-YVADAP-Lys(Dnp)-OH TFA

Cholinesterase (ChE) Caspase Others

Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme *(ACE), with an IC₅₀* of 9 μM.

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme *(ACE), with an IC₅₀* of 9 μM.

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Angiotensin-converting Enzyme (ACE)	Others
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination .

HY-P1853

Abz-FR-K(Dnp)-P-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay .

HY-P4545

Abz-Gly-p-nitro-Phe-Pro-OH	Peptides	Others
Abz-Gly-p-nitro-Phe-Pro-OH is the fluorescent substrate angiotensin I converting enzyme (ACE-I) with 355 nm excitation and 405 nm emission wavelengths .

HY-P4524

FA-Phe-Phe	Angiotensin-converting Enzyme (ACE)	Others
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of Cathepsin A .

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific angiotensin-converting enzyme (ACE) inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P4654

H-Tyr-Lys-OH	Angiotensin-converting Enzyme (ACE)	Others
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE) .

HY-P4279

Ovalbumin (154-159)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent angiotensin-converting enzyme (ACE) inhibitor. Ovalbumin (154-159) can be used for research of hypertension .

HY-P3985

Bradykinin potentiator B Bradykinin potentiating peptide B	Angiotensin-converting Enzyme (ACE)	Others
Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent *ACE* inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-P4257

L-Isoleucyl-L-arginine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
L-Isoleucyl-L-arginine is a dipeptide formed from L-isoleucine and L-arginine residues. L-Isoleucyl-L-arginine is a potent angiotensin-converting enzyme (ACE) inhibitor. L-Isoleucyl-L-arginine can be used for research of hypertension .

HY-P3258

SP-10	Cholinesterase (ChE)	Infection
SP-10 is a small peptide derived from S protein with an IC₅₀ value of 1.88 nM for blocks the interaction between S protein and *ACE2*. SP-10 can be used for SARS-CoV research .

HY-12403A

Talfirastide acetate Maximum Cited Publications 9 Publications Verification TXA127 ACEtate; Angiotensin (1-7) (ACEtate); Ang-(1-7) (ACEtate)	Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease Inflammation/Immunology Endocrinology
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine *ACE* activity (IC₅₀=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium .

HY-P4281

Ovotransferrin (328-332)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Neurological Disease
Ovotransferrin (328-332) has a protective activity on the blood pressure by inhibiting the Angiotensin-Converting Enzyme (ACE), with the IC₅₀ of 20 μM. Ovotransferrin (328-332) fragment has an activity against Cholinesterase (ChE), implicating in Alzheimer’s diseases .

HY-P5827

SBP1 peptide	SARS-CoV Angiotensin-converting Enzyme (ACE)	Infection
SBP1 peptide is a chemically synthesized 23-mer peptide fragment of the *ACE2* PD α1 helix. SBP1 peptide associates with micromolar affinity to insect-derived SARS-CoV-2-RBD protein .

HY-12403

Talfirastide Maximum Cited Publications 9 Publications Verification TXA127; Angiotensin (1-7); Ang-(1-7)	Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease Inflammation/Immunology Endocrinology
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine *ACE* activity (IC₅₀=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity .

HY-P10172

Abz-SDK(Dnp)P-OH	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl) .

HY-P0266B

N-Acetyl-Ser-Asp-Lys-Pro acetate Ac-SDKP ACEtate	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties .

HY-W012159

Methionylserine H-MET-SER-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a K_m value of 0.2 mM. Methionylserine inhibits *ACE* enzyme activity. Methionylserine can be used in the research of hypension .

HY-P4554

H-Phe-Arg-OH	Endogenous Metabolite	Metabolic Disease
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research .

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .

Cat. No.	Product Name	Target	Research Area

HY-P99590

Sotatercept ACE-011	TGF-β Receptor	Inflammation/Immunology Cancer
Sotatercept (ACE-011) is a soluble activin receptor 2A (ACVR2A) type IgG Fc fusion protein. Sotatercept combines activin and growth differentiation factor to try to restore the balance between growth promotion and growth inhibition signal pathways. Sotatercept has potential application in pulmonary arterial hypertension, anemia, bone loss, erythropoiesis, multiple myeloma (MM) osteolytic lesions .

HY-P99720

Luspatercept ACE-536; luspatercept–aamt	TGF-beta/Smad	Metabolic Disease
Luspatercept (ACE-536) is a recombinant modified ActRIIB fusion protein that binds with transforming growth factor β superfamily ligands. Luspatercept increases the erythrocyte numbers and promotes maturation of erythroid precursors. Luspatercept binds with GDF11 and inhibits Smad2/3 signaling. Luspatercept can be used for the research of anemia .

HY-P99818

Ramatercept ACE-031	TGF-β Receptor	Metabolic Disease
Ramatercept (ACE-031) is a soluble ActRIIB receptor and can be used as a soluble activin receptor 2 (ACVR2) antagonist. Ramatercept inhibits the signal pathway of muscle growth inhibition and has potential application in muscle atrophy .

HY-P99920

Efmitermant alfa ACE083	Inhibitory Antibodies	Others
Efmitermant alfa (ACE-083) is a locally acting, follistatin-based fusion protein. Efmitermant alfa also is a muscle-promoting agent. Efmitermant alfa can be used for the research of muscle disorders .

HY-P990180

Anti-Mouse NKG2A/C/E Antibody (20D5)	Inhibitory Antibodies	Others
Anti-Mouse NKG2A/C/E Antibody (20D5) is a rat-derived IgG2a, κ type antibody inhibitor, targeting to mouse NKG2A/C/E.

HY-P9801

Anti-Spike-RBD mAb 1 Publications Verification SARS-CoV-2 (2019-nCoV) Spike RBD Antibody	SARS-CoV	Infection
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment .

HY-P99346

Regdanvimab CT-P59	SARS-CoV Angiotensin-converting Enzyme (ACE)	Infection
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with *ACE2* for viral entry. Regdanvimab can be used for the research of COVID-19 .

Recombinant Proteins Recommended:

Angiotensin-I-Converting Enzyme (ACE)

Species:	Human (10) Virus (4) Rhesus Macaque (2) Rat (1) Mouse (2) Cynomolgus (3)
Tag:	His (16) Avi (6) Fc (8)
Source:	HEK293 (19) Sf9 insect cells (3) E. coli (1)

Cat. No.	Compare	Product Name	Species	Source

HY-P78055

	ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) ACE-2; ACEH; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

HY-P72808

	ACE2 Protein, Human (sf9, His) Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

HY-P78233

	ACE2 Protein, Cynomolgus (HEK293, His-Avi) ACE-2; ACEH; ACE2	Cynomolgus	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-His, C-Avi labeled tag. The total length of ACE2 Protein, Cynomolgus (HEK293, His-Avi) is 722 a.a., with molecular weight of 95-110 kDa.

HY-P78054

	ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) ACE-2; ACEH; ACE2	Cynomolgus	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 722 a.a., with molecular weight of 87-110 kDa.

HY-P72809

	ACE2 Protein, Rat (HEK293, His) Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rat	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.

HY-P74434

ACE2 Protein, Mouse (HEK293, His)

Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase
Mouse HEK293

HY-P7992

	ACE/CD143 Protein, Human (His) ACE, CD143, DCP, DCP1	Human	E. coli
	ACE/CD143 Protein, Human (His) is a recombinant human Angiotensin-converting enzyme/CD143 a His tag at the C-terminus. Angiotensin I-converting enzyme (ACE, CD143) hydrolyzes small peptides such as angiotensin I, bradykinin, substance P, LH-RH and several others and thus plays a key role in blood pressure regulation and vascular remodeling. ACE plays a crucial role in blood pressure regulation, vascular remodeling, and immunity.

HY-P72810

	ACE2 Protein, Rhesus Macaque (HEK293, Fc) Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rhesus Macaque	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P74433

	ACE2 Protein, Mouse (HEK293, His-Fc) Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 Protein, a crucial carboxypeptidase in the renin-angiotensin system, regulates blood volume and vascular resistance, maintaining cardiovascular homeostasis. It converts angiotensin I to anti-hypertrophic angiotensin 1-9 and angiotensin II to vasodilatory angiotensin 1-7, countering vasoconstriction. ACE2 also regulates amino acid transport, interacting with SLC6A19, and modulates vasoactive peptides like neurotensin and kinetensin. Its multifaceted functions make ACE2 pivotal in cardiovascular and amino acid homeostasis. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293, with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.

HY-P72807

	ACE2 Protein, Human (Biotinylated, sf9, His-Avi) Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.

HY-P72029

	ACE2 Protein, Macaca fascicularis (HEK293, hFc) ACE2; Angiotensin-converting enzyme	Cynomolgus	HEK293
	ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.

HY-P73489

	ACE2 Protein, Human (740a.a, HEK293, His) Angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (740a.a, HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P7828

	ACE2 Protein, Rhesus macaque (HEK293, His) rRhAngiotensin-converting enzyme/ACE-2, His; Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Rhesus Macaque	HEK293
	ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P7443

	ACE2 Protein, Human (HEK293, mFc) 1 Publications Verification Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

	ACE2 Protein, Human (HEK293, hFc, solution) 1 Publications Verification Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P700445

	ACE2 Protein, Paguma larvata (HEK293, hFc) Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Others	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.

HY-P70769

	ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P700455

	ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

HY-P7441

	ACE2 Protein, Human (723a.a, HEK293, His) 2 Publications Verification Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, His) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P75876

	*HA1/Hemagglutinin Protein, H3N8 (ACE81938, HEK293, His)* Influenza A H3N8 (A/equine/Gansu/7/2008) Hemagglutinin Protein (HA1 Subunit) (His)	Virus	HEK293
	Avian influenza virus (AIV) belongs to the genus Orthomyxovirus and contains eight single-stranded negative-sense RNA segments (PB2, PB1, PA, HA, NP, NA, M, and NS). The haemagglutinin (HA) protein presents as a homotrimer in which each monomer consists of two di-sulfide-linked HA1 and HA2 subunits after the cleavage of the HA0 precursor. The HA protein, which is responsible for receptor binding and membrane fusion, plays a key role in the influenza virus entry pathway. HA1/Hemagglutinin Protein, H3N8 (ACE81938, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag. The total length of HA1/Hemagglutinin Protein, H3N8 (ACE81938, HEK293, His) is 344 a.a., with molecular weight of ~37.9 kDa.

HY-P75877

	*HA1/Hemagglutinin Protein, H3N8 (ACE81938, sf9, His)* Influenza A H3N8 (A/equine/Gansu/7/2008) Hemagglutinin Protein (HA1 Subunit) (His)	Virus	Sf9 insect cells
	Avian influenza virus (AIV) belongs to the genus Orthomyxovirus and contains eight single-stranded negative-sense RNA segments (PB2, PB1, PA, HA, NP, NA, M, and NS). The haemagglutinin (HA) protein presents as a homotrimer in which each monomer consists of two di-sulfide-linked HA1 and HA2 subunits after the cleavage of the HA0 precursor. The HA protein, which is responsible for receptor binding and membrane fusion, plays a key role in the influenza virus entry pathway. HA1/Hemagglutinin Protein, H3N8 (ACE81938, sf9, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of HA1/Hemagglutinin Protein, H3N8 (ACE81938, sf9, His) is 344 a.a., with molecular weight of ~37.9 kDa.

HY-P75882

	*HA/Hemagglutinin Protein, H6N1 (529a.a, ACE81692, HEK293, His)* Influenza A H6N1 (A/northern shoveler/California/HKWF115/2007) Hemagglutinin / HA Protein (His)	Virus	HEK293
	The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis. HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions. HA/Hemagglutinin Protein, H6N1 (529a.a, ACE81692, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HA/Hemagglutinin Protein, H6N1 (529a.a, ACE81692, HEK293, His) is 529 a.a., with molecular weight of ~65 kDa.

HY-P75023

	*HA/Hemagglutinin Protein, H6N1 (344a.a, ACE81692, HEK293, His)* Influenza A H6N1 (A/northern shoveler/California/HKWF115/2007) Hemagglutinin Protein (HA1 Subunit) (HEK293, His)	Virus	HEK293
	The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis. HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions. HA/Hemagglutinin Protein, H6N1 (344a.a, ACE81692, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag. The total length of HA/Hemagglutinin Protein, H6N1 (344a.a, ACE81692, HEK293, His) is 344 a.a., with molecular weight of 45-55 kDa.

Cat. No.	Product Name	Chemical Structure

HY-B0331AS

Enalapril D5 maleate

Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.
HY-B0231BS

Enalaprilat-d5 sodium

Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
HY-A0116S

Trandolaprilate-d5

Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-B1433S

Perindoprilat-d3 disodium
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-A0115S2

Ramiprilat-d4 hydrochloride
Ramiprilat-d₄ hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-B0231AS

Enalaprilat-d5

Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
HY-108321S

Zofenopril-d5

Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
HY-B0279S

Ramipril-d5

Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S1

Ramipril-d3

Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.
HY-B0279S2

Ramipril-d4

Ramipril-d₄ is deuterated labeled Ramipril (HY-B0279). Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-B0592S

Trandolapril-d5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-117281S1

Moexipril-d3
Moexipril-d₃ is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of angiotensin-converting enzyme (ACE), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects ^- .

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-B0260S

Methylprednisolone-d3
Methylprednisolone-d₃ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S2

Methylprednisolone-d4
Methylprednisolone-d₄ is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S3

Methylprednisolone-d7
Methylprednisolone-d₇ is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S4

Methylprednisolone-d2
Methylprednisolone-d₂ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3][4].

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-127026S

Quinaprilat-d5
Quinaprilat-d₅ is a deuterium-labeled Quinaprilat. Quinaprilat is a nonsulfhydryl ACE inhibitor, the active diacid metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits bradykinin degradation. Quinaprilat primarily acts as a vasodilator, decreasing total peripheral and renal vascular resistance[1].

HY-B0368S

Captopril-d3
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

HY-113478S

Ursodeoxycholic acid-2,2,4,4-d4

Ursodeoxycholic acid-2,2,4,4-d₄ is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P82349

Angiotensin Converting Enzyme 1 Antibody (YA2094)

ACE; Dipeptidyl carboxypeptidase I; Kininase II
WB, IHC-P Mouse, Rat

HY-P81084

	ACE Antibody Angiotensin Converting Enzyme 1; ACE; ACE-T; Angiotensin-converting enzyme isoform 1precursor; Dipeptidyl carboxy peptidase 1; Kininase II; ACE-1; testis-specific isoform precursor. ACE 1; ACE T; ACE1; Angiotensin converting enzyme somatic isoform; Angiotensin converting enzyme testis specific isoform; Angiotensin I converting enzyme; Angiotensin I converting enzyme 1; Angiotensin I converting enzyme peptidyl dipeptidase A 1; Carboxycathepsin; CD 143; CD143; CD143 antigen; DCP 1; DCP; DCP1; Dipeptidyl carboxypeptidase 1; MVCD3; Peptidase P; Peptidyl dipeptidase A; Testicular ECA; ACE_HUMAN.	WB, ELISA, IHC-P, IHC-F, ICC/IF	Human, Mouse, Rat
	ACE Antibody is an unconjugated, approximately 147 kDa, rabbit-derived, anti-ACE polyclonal antibody. ACE Antibody can be used for: WB, ELISA, IHC-P, IHC-F, ICC, IF expriments in human, mouse, rat, and predicted: dog, pig, cow, sheep background without labeling.

HY-P80003

	ACE2 Antibody ACE-2; ACE 2; Angiotensin converting enzyme 2; ACE related carboxypeptidase; ACEH; Angiotensin converting enzyme homolog; Angiotensin converting enzyme like protein; Angiotensin I Converting Enzyme (peptidyl dipeptidase A) 2; Angiotensin I converting enzyme 2; DKFZP434A014; EC 3.4.17; angiotensin-converting enzyme 2 precursor; ACE2_HUMAN; Angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15; Processed angiotensin-converting enzyme 2.	WB, ICC/IF, IHC-P, IP	Human, Mouse, Hamster
	ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks