country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10721

Copy Link Print Information

Plectasin

Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia caused by pneumococcus in mice.

For research use only. We do not sell to patients.

Formula: C₁₈₉H₂₆₇N₅₃O₅₆S₇
Molecular Weight:4401.92

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Plectasin Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All Antibiotic Isoforms :

Chemical Information

Molecular Weight 4401.92
Formula C₁₈₉H₂₆₇N₅₃O₅₆S₇
Sequence

Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly-Gly-Phe-Val-Cys-Lys-Cys-Tyr (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39)
Sequence Shortening

GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Mygind PH, et al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature. 2005 Oct 13;437(7061):975-80. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock