Papiliocin
Papiliocin is a potent peptide antibiotic with both anti-inflammatory and antibacterial activities. Papiliocin is primarily active against Gram-negative bacteria. Papiliocin exhibits strong anti-inflammatory activity against cell, exerting its anti-inflammatory activity by inhibiting the production of NO and the secretion of TNF-α and MIP-2. Papiliocin participates in the innate defense response mechanism by inhibiting the Toll-like receptor pathway and NF-κB. Papiliocin induces apoptosis in fungal cells and increases the total level of intracellular ROS. Papiliocin acts as an effective antiseptic peptide in sepsis models. Papiliocin is useful in anti-inflammatory and antibacterial research.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C183H314N56O44
- Masse moléculaire:4002.80
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Voir tous les produits spécifiques à Isoform Antibiotic
MoreVoir tous les produits spécifiques à Isoform TNF Receptor
More
Activité biologique
Description
IC50 & Target
[1]|
IL-1β |
IL-6 |
TLR4 |
iNOS |
In Vitro
Papiliocin (37 °C for 16 h) shows antibacterial activity against Gram-negative species (E. coli, S. typhimurium, and P. aeruginosa) and Gram-positive species (B. subtilis, S. epidermidis, and S. aureus), with MICs of 0.25, 0.5, 1, 16, 2, 32 μM[1].
Papiliocin is calcium- and magnesium-tolerant to Gram-negative bacteria[1].
Papiliocin (0-100 μM, 37 °C for 1 h) lacks hemolytic activity and is not cytotoxic to RAW264.7 cells, with an IC50 of 58 μm[1].
Papiliocin (0-25 μM, 3-24 h) inhibits the expression of NO, TNF-α, MIP-2, iNOS, TLR4, NF-κB, and all inflammatory cytokines IL-1β, IL-6, MIP-1, MIP-2, and TNF-α genes in LPS (HY-D1056)-stimulated RAW264.7 cells[1].
Papiliocin (0-10 μM) induces lipid vesicle permeabilization, shows low Stern-Volmer quenching constants (KSV) in micelles or SUVs, results in the dissociation of LPS aggregates through interaction with LPS[1].
Papiliocin (30 μM, 28 °C for 2 h) induces ROS production and increases intracellular hydroxyl radical levels in Candida albicans cells[2].
Papiliocin (30 μM, 28 °C for 2 h) induces apoptotic cell death, membrane depolarization and metacaspase activation, DNA damage in Candida albicans cells[2].
Papiliocin (0-50 μM) displaces 74.6% of the BC probes from LPS, neutralizes LPS, with the binding affinity of 0.063 μM[3].
Papiliocin (40 μM, 30 min) inhibits 52% of FITC-LPS binding to the surface of RAW 264.7 cells, but also competitively displaces 25% of pre-bound LPS from the LPS-receptor complex on RAW 264.7 cells[3].
Papiliocin (0-100 μM) reduces TLR4-mediated SEAP activity with an IC50 of 1.1 μM[3].
Papiliocin (0.1-10 μM, 1 h) blocks the LPS-induced inflammatory cascade by targeting TLR4 and the MAPK pathway and by blocking the nuclear translocation of p-NF-κB in RAW 264.7 cells[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
-
Cell Line:LPS (20 ng/mL)-stimulated RAW264.7 cells
-
Concentration:1, 10 μM
-
Incubation Time:18 h
-
Result:Inhibited the production of TNF-α and MIP-2.
-
Cell Line:LPS (20 ng/mL)-stimulated RAW264.7 cells
-
Concentration:20 μM
-
Incubation Time:3 h
-
Result:Inhibited the expression of iNOS and all inflammatory cytokines, including IL-1β, IL-6, MIP-1, MIP-2, and TNF-α.
-
Cell Line:LPS (20 ng/mL)-stimulated RAW264.7 cells
-
Concentration:25 μM
-
Incubation Time:24 h
-
Result:Inhibited TLR4 and NF-κB expression and prevented the translocation of NF-κB from the cytoplasm to the nucleus.
-
Cell Line:Candida albicans cells
-
Concentration:30 μM
-
Incubation Time:28 °C for 2 h
-
Result:Induced apoptosis cell death, with the early apoptotic cells of 61.14%, the late apoptotic of 0.52%.
Induced the breakdown of ΔΨm and the loss of mitochondrial permeability.
Induced the generation of strong oxidant hydroxyl radicals.
Increased the proportion of TUNEL-positive cell nuclei.
-
Cell Line:LPS (50 ng/mL)-stimulated RAW264.7 cells
-
Concentration:0.1, 0.5, 1 μM
-
Incubation Time:1 h
-
Result:Reduced MyD88 overexpression and phosphorylation levels of TAK1, p38, c-Jun N-terminal kinase (JNK), and extracellular signal-regulated kinase (ERK).
-
Cell Line:LPS (50 ng/mL)-stimulated RAW264.7 cells
-
Concentration:10 μM
-
Incubation Time:1 h
-
Result:Reduced expression of Alexa 546 inhibited Lp-NF-κB p65 translocation.
Chemical Information
-
Masse moléculaire 4002.80
-
Formule C183H314N56O44
-
Sequence
Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Val-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Ala-Thr-Val-Val-Lys-NH2
-
Sequence Shortening
RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocole
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Apoptosis
Apoptosis, also called programmed cell death, is generally characterized by distinct morphological characteristics.
-
TUNEL staining for apoptotic DNA fragmentation
TUNEL staining detects DNA strand breaks by using terminal deoxynucleotidyl transferase to add labeled nucleotides to exposed 3′-OH DNA termini, generating either microscopic staining in fixed cells or tissue sections, or fluorescence/cytometric signal in cell suspensions. TUNEL positivity reflects DNA fragmentation but should not be interpreted alone as definitive apoptosis, because TUNEL can also label necrotic, autolytic, mechanically damaged, or DNA-repair-associated DNA breaks.
-
LPS-Induced Endotoxemia/Systemic Inflammation
Lipopolysaccharide (LPS)-induced endotoxemia is a widely used in vivo model of acute systemic inflammation in which LPS, a Gram-negative bacterial endotoxin, activates innate immune signaling primarily through TLR4, leading to rapid and transient induction of pro-inflammatory cytokines such as TNF-α, IL-6, and IL-1β in circulation and tissues. This cytokine surge is commonly used as a measurable readout of systemic inflammatory activation and immune dysregulation, and is typically assessed within hours after intraperitoneal LPS administration in mouse models of endotoxemia. The model captures key features of systemic inflammatory response syndrome, including cytokine release, immune cell activation, and downstream tissue responses, and has been used to evaluate anti-inflammatory interventions such as cytokine modulation, lipid mediators, and immune cell-targeting therapies.
-
Annexin V plus membrane-impermeant dye apoptosis staining
Annexin V-based apoptosis assays rely on the detection of phosphatidylserine (PS) externalization from the inner leaflet of the plasma membrane to the outer leaflet, an early biochemical hallmark of apoptosis. Fluorescently labeled Annexin V binds PS in a calcium-dependent manner, enabling identification of early apoptotic cells by flow cytometry or fluorescence microscopy. When combined with a membrane-impermeant DNA-binding dye (e. g. , propidium iodide), this approach allows discrimination between viable (Annexin V−/dye−), early apoptotic (Annexin V+/dye−), and late apoptotic or necrotic (Annexin V+/dye+) cell populations by assessing membrane integrity and PS exposure.
-
Cotton Pellet Granuloma
Cotton pellet granuloma is a classical in vivo chronic inflammation model used to evaluate the anti-inflammatory potential of test substances by measuring their ability to inhibit granuloma tissue formation around an implanted foreign body (cotton pellet) in rodents. The method is based on the biological response to a sterile implanted material, which induces proliferative phase inflammation characterized by fibroblast proliferation and collagen-rich granuloma formation, and the final readout reflects the extent of chronic inflammatory tissue growth surrounding the pellet. In multiple preclinical pharmacological evaluations, inhibition of cotton pellet-induced granuloma formation has been used as an indicator of anti-inflammatory activity in both synthetic and natural product screening contexts.
-
ROS/oxidative-stress fluorescent staining
ROS/oxidative-stress fluorescent staining uses cell-permeant fluorogenic probes that become fluorescent after oxidation inside cells or tissues; commonly used examples include DCFH-DA/DCFDA for broad cellular oxidant detection, DHE for superoxide-related signal detection, MitoSOX for mitochondrial superoxide-related signal detection, and CellROX probes for oxidative-stress-associated fluorescence readouts. The assay detects probe oxidation rather than a single ROS species unless the probe and analysis method have been chemically validated for that species. DCFH-DA enters cells, is deacetylated by intracellular esterases to DCFH, and produces fluorescent DCF after oxidation, so the readout is used as an operational measure of total cellular oxidative stress rather than a species-specific ROS measurement. DHE and MitoSOX can report superoxide-related oxidation, but red fluorescence alone can include non-specific ethidium-like oxidation products; HPLC or optimized spectral approaches are
-
Carrageenan-Induced Paw Edema
Carrageenan-induced paw edema is an acute inflammation model in which intraplantar injection of carrageenan induces localized inflammatory swelling characterized by vascular permeability, leukocyte infiltration, and production of inflammatory mediators such as prostaglandins and cytokines, making it widely used to evaluate anti-inflammatory agents in vivo. The resulting paw volume or thickness increase is quantified over time as a direct readout of inflammatory intensity and drug efficacy, typically reflecting cyclooxygenase-mediated prostaglandin-driven edema formation and immune cell recruitment in peripheral tissue[20].
-
Apoptosis Solutions
Apoptosis is a regulated, generally non-lytic cell-death pathway that removes unwanted, damaged, infected, or abnormal cells through coordinated morphological changes, caspase activation, DNA fragmentation, and membrane remodeling. The intrinsic apoptosis pathway is controlled mainly by mitochondrial outer membrane permeabilization, BCL-2 family proteins, cytochrome c release, apoptosome formation, caspase-9 activation, and downstream executioner caspase-3/7 activation. The extrinsic apoptosis pathway is initiated by death receptors such as Fas, TNFR, and TRAIL receptors, which recruit adaptor proteins and activate caspase-8 before engaging executioner caspases or mitochondrial amplification through BID cleavage. Apoptosis is linked to many phenotypes, including cancer cell killing, tissue homeostasis, immune regulation, neurodegeneration, infection response, and treatment-induced cytotoxicity; unresolved questions include how apoptosis interacts with necroptosis, pyroptosis, ferroptos
-
Research Protocol for Inflammation-related Diseases
The NLRP3 inflammasome is a cytosolic innate immune signaling platform that integrates priming signals and danger-signal activation to promote caspase-1 activation, maturation of IL-1β and IL-18, and gasdermin D-mediated pyroptotic cell death. The core experimental logic is to determine whether inflammatory disease phenotypes are driven by increased NLRP3 expression, ASC-containing inflammasome assembly, caspase-1 cleavage, GSDMD cleavage, and extracellular release of IL-1β/IL-18 rather than by nonspecific cell injury alone. The pathway is strongly linked to inflammation-related disease phenotypes because monosodium urate crystals activate NALP3/NLRP3 inflammasome signaling in gout-like crystal inflammation, cholesterol crystals activate NLRP3 inflammasomes in atherogenesis models, and DSS-induced intestinal inflammation has been reported to involve NLRP3 inflammasome activity. However, experimental colitis studies also show context-dependent protective effects of NLRP3 inflammasome co
-
Gram Staining of Tissue Sections
Gram staining of tissue sections is a histochemical technique used to differentiate Gram-positive and Gram-negative bacteria within histological specimens based on differences in bacterial cell wall structure and dye retention, adapted from classical bacteriological Gram staining into tissue-compatible “histological Gram stain” variants. In tissue applications, modifications of the Brown-Hopps and Brown-Brenn methods are commonly used to improve differentiation of microorganisms embedded within host connective tissue and to reduce overstaining or loss of Gram-negative signal, which are known limitations of earlier approaches. The principle relies on crystal violet-iodine complex retention in Gram-positive organisms and subsequent decolorization and counterstaining steps that allow contrast visualization of Gram-negative organisms against tissue background.
Pureté et documentation
Références
[1]. Kim JK, et al. Structure and function of papiliocin with antimicrobial and anti-inflammatory activities isolated from the swallowtail butterfly, Papilio xuthus. J Biol Chem. 2011 Dec 2;286(48):41296-41311. [Content Brief]
[2]. Hwang B, et al. Induction of yeast apoptosis by an antimicrobial peptide, Papiliocin. Biochem Biophys Res Commun. 2011 Apr 29;408(1):89-93. [Content Brief]
[3]. Krishnan M, et al. Molecular mechanism underlying the TLR4 antagonistic and antiseptic activities of papiliocin, an insect innate immune response molecule. Proc Natl Acad Sci U S A. 2022 Mar 8;119(10):e2115669119. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)