Lixisenatide
Based on 3 publication(s) in Google Scholar
Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis, diabetes, Alzheimer's disease and atherosclerosis.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.84%
- No. CAS: 320367-13-3
- Fòrmula: C215H347N61O65S
- Peso molecular:4858.49
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Lixisenatide
More-
In Vivo Efficacy Study
-
WB
-
IHC
Ver todos los productos específicos de isoformas MEK
More
Actividad biológica
|
GLP-1 |
MEK1 |
MEK2 |
MMP-1 |
MMP-3 |
MMP13 |
Lixisenatide (100 μM, 24 h) inhibits the Aβ25-35 (HY-P0128)-induced cytotoxicity on cultured hippocampal cells. [1].
Lixisenatide (100 μM, 24 h) relieves the Aβ25-35-induced suppression of the Akt-MEK1/2 signaling pathway on cultured hippocampal cells [1].
Lixisenatide (10-20 μM, 48 h) ameliorates IL-1β-induced oxidative stress, mitochondrial dysfunction, and apoptosis in fibroblast-like synoviocytes (FLSs) [3].
Lixisenatide (10-20 μM, 48 h) reduces IL-1β-induced expression of MMPs and inhibits activation of proinflammatory pathways by IL-1β in FLSs[3].
Lixisenatide (10-20 μM, 6 h) reduced oxygen-glucose deprivation/reperfusion (OGD/R)-induced generation of ROS in HUVECs[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Fibroblast-like synoviocytes
-
Concentration:10 and 20 μM
-
Incubation Time:48 h
-
Result:Significantly reduced expression of MMP-1, MMP-3, and MMP-13 at both the mRNA and protein levels in a dose-dependent manner.
Lixisenatide (1 nmol/kg, Intraperitoneal injection, once a day for 14 days) shows renoprotective effects on experimental early diabetic nephropathy in diabetic rats [4].
Lixisenatide (1-10 mg/kg, i.p., daily for 10 weeks) improves cognitive ability in APP/PS1 mice[6].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Apoe−/− Irs2+/− mice models[2]
-
Dosage:10 μg/kg
-
Administration:Subcutaneously injection, daily for a month
-
Result:Exhibited smaller atheromas in the aortic arch region.
Reduced the lesion size in cross-sections of hearts.
-
Animal Model:Diabetic rats[4]
-
Dosage:1 nmol/kg
-
Administration:Intraperitoneally injection, once a day for a month
-
Result:Showed a significant amelioration on the elevated renal parameters.
Showed significant mitigation in renal MDA and total NOx− (by 50.3 and 79.9%, respectively) and 43.9% elevation in renal total antioxidant capacity.
Averted the observed increments in iNOS and COX-2 expressions in the renal tissues of the diabetic group.
Decreased the level of TGF-β protein expression.
-
Animal Model:APP/PS1 mice[6]
-
Dosage:1 and 10 mg/kg
-
Administration:Intraperitoneally injection, daily for 10 weeks
-
Result:Improved cognitive ability.
Prevented the reduction of synapse numbers.
Reduced amyloid plaque load and chronic inflammation response (microglial activation).
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
No. CAS 320367-13-3
-
Appearance Solid
-
Peso molecular 4858.49
-
Fòrmula C215H347N61O65S
-
Color White to pink
-
Sequence
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2
-
Sequence Shortening
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Biomacromolecules
Poly(l-threonine- co-l-threonine Succinate) Thermogels for Sustained Release of Lixisenatide. [Abstract]2024 Aug 12;25(8):4946-4955. PMID: 38949062 -
J Mol Neurosci
Lixisenatide Reduced Damage in Hippocampus CA1 Neurons in a Rat Model of Cerebral Ischemia-Reperfusion Possibly Via the ERK/P38 Signaling Pathway. [Abstract]2020 Jul;70(7):1026-1037. PMID: 32040827
Lixisenatide purchased from MedChemExpress. Usage Cited in: J Mol Neurosci. 2020 Jul;70(7):1026-1037. [Abstract]
Two different doses of lixisenatide (Lixi: 0.7 and 7 nmol/kg) were given to rats for 2 weeks before induction of cerebral I/R. High-dose of Lixi was more effective than the lower dose.
Lixisenatide purchased from MedChemExpress. Usage Cited in: J Mol Neurosci. 2020 Jul;70(7):1026-1037. [Abstract]
Effects of lixisenatide (Lixi: 7 nmol/kg) on MAPK. Western blot and statistical analysis of pERK.
Lixisenatide purchased from MedChemExpress. Usage Cited in: J Mol Neurosci. 2020 Jul;70(7):1026-1037. [Abstract]
Effects of lixisenatide (Lixi: 7 nmol/kg) on proapoptotic and antiapoptotic markers. Immunohistochemistry analysis of bax, bcl-2, and caspase-3 in hippocampus CA1 pyramidal neurons.
-
Solvente y solubilidad
H2O : 100 mg/mL (20.58 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureza y Documentación
-
Ficha de datos (298 KB)
-
SDS (419 KB)
- English - EN (419 KB)
- Français - FR (419 KB)
- Deutsch - DE (419 KB)
- Norwegian - NO (419 KB)
- Español - ES (419 KB)
- Swedish - SV (419 KB)
- Italian - IT (419 KB)
- Korean - KR (419 KB)
- Portuguese - PT (419 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Cai HY, et al. Lixisenatide attenuates the detrimental effects of amyloid β protein on spatial working memory and hippocampal neurons in rats. Behav Brain Res. 2017 Feb 1;318:28-35. [Content Brief]
[2]. Vinué Á, et al. The GLP-1 analogue lixisenatide decreases atherosclerosis in insulin-resistant mice by modulating macrophage phenotype. Diabetologia. 2017 Sep;60(9):1801-1812. [Content Brief]
[3]. Du X, et al. The protective effects of lixisenatide against inflammatory response in human rheumatoid arthritis fibroblast-like synoviocytes. Int Immunopharmacol. 2019 Oct;75:105732. [Content Brief]
[4]. Abdel-Latif RG, et al. Low-dose lixisenatide protects against early-onset nephropathy induced in diabetic rats. Life Sci. 2020 Dec 15;263:118592. [Content Brief]
[5]. Xiao M, et al. The protective effects of GLP-1 receptor agonist lixisenatide on oxygen-glucose deprivation/reperfusion (OGD/R)-induced deregulation of endothelial tube formation. RSC Adv. 2020 Mar 10;10(17):10245-10253. [Content Brief]
[6]. McClean PL, et al. Lixisenatide, a drug developed to treat type 2 diabetes, shows neuroprotective effects in a mouse model of Alzheimer's disease. Neuropharmacology. 2014 Nov;86:241-58. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2058 mL | 1.0291 mL | 2.0583 mL | 5.1456 mL |
| 5 mM | 0.0412 mL | 0.2058 mL | 0.4117 mL | 1.0291 mL | |
| 10 mM | 0.0206 mL | 0.1029 mL | 0.2058 mL | 0.5146 mL | |
| 15 mM | 0.0137 mL | 0.0686 mL | 0.1372 mL | 0.3430 mL | |
| 20 mM | 0.0103 mL | 0.0515 mL | 0.1029 mL | 0.2573 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.