Candidalysin
Based on 1 Customer Validation
Candidalysin is a cytolytic peptide toxin secreted by the fungus Candida albicans. Candidalysin drives epithelial immune responses by activating the EGFR-MAPK signaling pathway, inducing MMP expression and calcium influx, and regulating the c-Fos transcription factor and MKP1 via p38 MAPK and ERK1/2 respectively. Candidalysin is essential for mucosal and systemic infections, activating NLRP3 to promote inflammatory responses, neutrophil recruitment, and Th17 immunity. Candidalysin activates LDH causing membrane damage and exhibiting cytotoxicity
For research use only. We do not sell to patients.
- Purity: 99.81%
- CAS No.: 1906866-53-2
- Formula: C153H266N38O38S2
- Molecular Weight:3310.11
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Candidalysin (3-70 μM, 2 h) induces phosphorylation of EGFR at Y1068 and Y845 in TR146 cells in a dose-dependent manner[1].
Candidalysin (3-70 μM, 2 h-24 h) induces immune response in TR146 cells that are mediated by MMP and calcium influx[1].
Candidalysin (1.5-70 μM, 24 h) induces the release of LDH in A431 vaginal epithelial cells in a dose-dependent manner[2].
Candidalysin (1.5-70 μM, 24 h) upregulates the expression levels of proinflammatory cytokines IL-1α, IL-1β, G-CSF, GM-CSF, IL-6 and IL-8 secreted by A431 vaginal epithelial cells[2].
Candidalysin (10-50 μM, 2 h) activates NLRP3 inflammasome and specifically stimulates bone marrow-derived macrophages (BMDM) to secrete IL-1β[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:TR146 cells
-
Concentration:3, 15, 70 μM
-
Incubation Time:2 h
-
Result:Up-regulated the protein levels of pEGFR Y1068 and pEGFR Y845.
-
Cell Line:BMDM
-
Concentration:10, 50 μM
-
Incubation Time:2 h
-
Result:Up-regulated the protein levels of IL-1β.
Candidalysin (wild-type C. albicans infection) (5×108 cfu/ml, Intravaginally inoculated, once) induces neutrophil recruitment and mucosal damage in the vulvovaginal candidiasis (VVC) mouse model[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Murine OPC model (female Balb/c mice 22-25 g)[1]
-
Dosage:107 cfu/ml C. albicans yeast culture
-
Administration:Sub-lingually for 75 min, once
-
Result:Compared with those lacking the candidalysin parent gene ECE1 (ece1Δ/Δ) or the candidalysin-encoding region (ece1Δ/Δ+ECE1Δ184-279), wild-type (WT) C. albicans infection induced lower levels of pEGFR Y1068 in tongue tissues.
-
Animal Model:Murine VVC model (female 6-8 weeks old C57BL/6 mice)[2]
-
Dosage:5×108 cfu/ml C. albicans, 10 μL of the standardized blastoconidial cell suspension, generating an inoculum size of 5×106 blastoconidia.
-
Administration:Intravaginally inoculated, once
-
Result:Increased fungal burden.
Increased LDH activity.
Chemical Information
-
CAS No. 1906866-53-2
-
Appearance Solid
-
Molecular Weight 3310.11
-
Formula C153H266N38O38S2
-
Color White to off-white
-
Sequence
Ser-Ile-Ile-Gly-Ile-Ile-Met-Gly-Ile-Leu-Gly-Asn-Ile-Pro-Gln-Val-Ile-Gln-Ile-Ile-Met-Ser-Ile-Val-Lys-Ala-Phe-Lys-Gly-Asn-Lys
-
Sequence Shortening
SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 25 mg/mL (7.55 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 25 mg/mL (7.55 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Select the appropriate dissolution method based on your experimental animal and administration route.
- For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
- To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for In Vivo experiments, it is recommended to prepare freshly and use it on the same day.
- The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: 10% DMSO 40% PEG300 5% Tween-80 45% Saline
Solubility: ≥ 2.5 mg/mL (0.76 mM); Clear solution
This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.
Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Working solution concentration: 0.22 mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
Purity & Documentation
-
Data Sheet (287 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Ho J, et al. Candidalysin activates innate epithelial immune responses via epidermal growth factor receptor. Nat Commun. 2019 May 24;10(1):2297. [Content Brief]
[2]. Richardson JP, et al. Candidalysin Drives Epithelial Signaling, Neutrophil Recruitment, and Immunopathology at the Vaginal Mucosa. Infect Immun. 2018 Jan 22;86(2):e00645-17. [Content Brief]
[3]. Rogiers O, et al. Candidalysin Crucially Contributes to Nlrp3 Inflammasome Activation by Candida albicans Hyphae. mBio. 2019 Jan 8;10(1):e02221-18. [Content Brief]
[4]. Naglik JR, et al. Candidalysin: discovery and function in Candida albicans infections. Curr Opin Microbiol. 2019 Dec;52:100-109. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.3021 mL | 1.5105 mL | 3.0210 mL | 7.5526 mL |
| 5 mM | 0.0604 mL | 0.3021 mL | 0.6042 mL | 1.5105 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Candidalysin Related Classifications
HY-P10408 Related Classifications
Powered by Bioz