Secretoneurin, rat
Based on 1 Customer Validation
Secretoneurin, rat is a 33-amino acid neuropeptide produced by proteolytic processing of chromogranin II, widely distributed in the central and peripheral nervous systems, and its release is calcium-dependent. Secretoneurin, rat modulates the activities of caspase-3, caspase-1, the NLRP3 inflammasome, IGF-1R, VEGFR1, VEGFR2, FGFR3, AMPK, ERK1/2/MAPK, and Jak2/Stat3 pathways. Secretoneurin, rat regulates neuronal apoptosis, synaptic structure, inflammation, neurogenesis, angiogenesis, oxidative stress, cardiomyocyte hypertrophy, dopamine release, and cell migration and proliferation. Secretoneurin, rat is used in studies of global cerebral ischemia, myocardial infarction, stroke, and cardiac hypertrophy.
For research use only. We do not sell to patients.
- Purity : 98.93%
- CAS No.: 149146-12-3
- Formula: C159H252N40O58
- Molecular Weight:3651.95
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
All Dopamine Receptor Isoforms
MoreAll Caspase Isoforms
MoreAll VEGFR Isoforms
MoreAll AMPK Isoforms
More
Biological Activity
Description
|
Caspase-3 |
Caspase-1 |
NLRP3 |
VEGFR1 |
IGF-1R |
VEGFR2 |
FGFR3 |
AMPK |
ERK1 |
ERK2 |
p38 MAPK |
JAK2 |
STAT3 |
In Vitro
Secretoneurin, rat (1-100 ng/mL) induces dose-dependent chemotactic migration of human coronary artery endothelial cells, with a maximum relative chemotactic index of 2.4 at 100 ng/mL[2].
Secretoneurin, rat (100 pg/mL-100 ng/mL; 6 hours) induces capillary-like tube formation in human coronary artery endothelial cells, with a maximum relative tube formation of 2.2 at 10 ng/mL after 6 hours[2].
Secretoneurin, rat (100 ng/mL; 5-240 minutes) activates both ERK (starting at 20 minutes) and Akt (starting at 40 minutes) in human coronary artery endothelial cells, with activation lasting up to 4 hours[2].
Secretoneurin, rat (100 ng/mL; 40-120 minutes) stimulates phosphorylation of VEGFR1, VEGFR2, FGFR3, and IGF-1R in human coronary artery endothelial cells[2].
Secretoneurin, rat (100 ng/mL) stimulates proliferation of human coronary artery endothelial cells to a relative level of 1.42, dependent on both VEGFR2 and MAPK pathway activity[2].
Secretoneurin, rat (100 ng/mL) increases both the binding capacity and affinity of VEGF to human coronary artery endothelial cells in a heparan sulfate proteoglycan-dependent manner[2].
Secretoneurin, rat (10-100 ng/mL) increases VEGF binding to Heparin (HY-17567) in a cell-free system[2].
Secretoneurin, rat increases VEGF binding to its coreceptor neuropilin-1 in a cell-free system[2].
Secretoneurin, rat (100 ng/mL) inhibits apoptosis in starved human coronary artery endothelial cells, reducing the percentage of TUNEL-positive cells from 26.4% to 17.4%[2].
Secretoneurin, rat (1 μg/L; pretreatment before 2 h OGD) reduced caspase‑3 activity in primary cortical cells from embryonic Sprague‑Dawley rats subjected to oxygen‑glucose deprivation (OGD)[3].
Secretoneurin, rat (1 μg/L; pretreatment before 2 h OGD) decreased the number of activated caspase‑3‑positive cells in primary cortical cells from embryonic Sprague‑Dawley rats subjected to oxygen‑glucose deprivation (OGD)[3].
Secretoneurin, rat (1 μg/L; 12 h pretreatment before OGD) prevented oxygen‑glucose deprivation (OGD)‑induced down‑regulation of the anti‑apoptotic protein Bcl‑2 in primary cortical cells from embryonic Sprague‑Dawley rats.
Secretoneurin, rat (1 μg/L; 20 min pretreatment before 4 h OGD) pre‑treated primary cortical cells of embryonic Sprague‑Dawley rats 20 min before 4‑h OGD decreased LDH release and maintained MAP‑2‑positive neuron density, while post‑OGD treatment showed no efficacy[3].
Secretoneurin, rat (0.01‑10 μg/L; 0.5‑12 h) activated the Jak2/Stat3 pathway in a time‑ and dose‑dependent manner in primary cortical cells derived from embryonic Sprague‑Dawley rats, with each phosphorylated protein (p‑Stat3 and p‑Jak2) showing an approximately 2‑fold maximum increase relative to actin[3].
Secretoneurin, rat (1 μg/L; 1-28 days)‑mediated protection of MAP‑2‑positive neurons under OGD conditions in primary cortical cells from embryonic Sprague‑Dawley rats was abolished by the Jak2 inhibitor AG490 (HY‑12000)[3].
Secretoneurin, rat is widely distributed in postmortem human eye tissues, with the highest concentration in the choroid followed by the retina, iris/ciliary body, sclera, and cornea[5].
Secretoneurin, rat-immunoreactive nerve fibers are widely distributed throughout the anterior segment and choroid of postmortem human eyes, innervating the cornea, limbus, trabecular meshwork, iris, ciliary body, and choroid[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
-
Cell Line:human coronary artery endothelial cells (HCAECs)
-
Concentration:100 ng/mL
-
Incubation Time:5, 20, 40, 60, 120, and 240 minutes
-
Result:Stimulated MAPK (ERK) phosphorylation starting after 20 minutes, with continuing long-lasting stimulation until 240 minutes.
Activated Akt after 40 minutes, with a 4-hour duration of activation.
Stimulated the phosphorylation of VEGFR1, VEGFR2, FGFR3, and IGF-1R in human coronary artery endothelial cells.
-
Cell Line:primary cortical cells from gestation day-17 Sprague-Dawley rat embryos
-
Concentration:1 μg/L
-
Incubation Time:pretreatment before 2 hours of OGD
-
Result:Decreased the number of caspase-3-positive immunofluorescent cells significantly relative to controls, indicating reduced numbers of cells undergoing OGD-induced apoptosis.
-
Cell Line:primary cortical cells from gestation day-17 Sprague-Dawley rat embryos
-
Concentration:1 μg/L
-
Incubation Time:12 hours of pretreatment before OGD exposure
-
Result:Considerably inhibited the OGD-induced reduction in Bcl-2 expression, indicating preservation or upregulation of Bcl-2 expression under ischemic stress.
-
Cell Line:primary cortical cells from gestation day-17 Sprague-Dawley rat embryos
-
Concentration:0.01, 0.1, 1, 10 μg/L (dose response)
-
Incubation Time:0.5, 1, 3, 8, 12 hours (time course)
-
Result:Increased the levels of phosphorylated Jak2 and phosphorylated Stat3 in primary cortical cells in a time-dependent and dose-dependent manner.
The ratio of phosphorylated Stat3 to actin protein peaked at approximately a 2-fold increase in treated cells compared with control cells.
The ratio of phosphorylated Jak2 to actin protein also peaked at approximately a 2-fold increase relative to controls.
Did not significantly alter total Stat3 and total Jak2 protein levels compared with control cells.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dawley (male; 3-month-old)[1]
-
Dosage:1 μg per ventricle
-
Administration:i.c.v. infusion; single dose; 24 h after GCI
-
Result:Exhibited significantly fewer searching errors on days 14-16 of Barnes maze training compared with vehicle-treated GCI rats, with performance comparable to sham controls.
Spent more time in the target quadrant on the day 17 probe trial than GCI vehicle-treated rats.
Significantly attenuated GCI-induced increases in AIF and cleaved-PARP1 immunofluorescence intensity in the hippocampal CA1 region at day 5 post-GCI.
Reduced the number of TUNEL-positive apoptotic cells in the hippocampal CA1 region at day 5 post-GCI.
Preserved synaptophysin and spinophilin synaptic granule density in the hippocampal CA1 region at day 5 post-GCI.
Significantly inhibited GCI-induced activation of caspase-1 and caspase-3 in the hippocampal CA1 region at day 5 post-GCI.
Decreased the levels of pro-inflammatory cytokines IL-1β and IL-18 in the hippocampal CA1 region at day 5 post-GCI.
Markedly reduced GCI-elevated NLRP3-ASC and ASC-caspase-1 protein interactions in the hippocampal CA1 region at day 5 post-GCI as measured by proximity ligation assay.
Attenuated GCI-induced NLRP3 protein elevation in hippocampal CA1 neurons at day 5 post-GCI.
Preserved CA1 pyramidal neuron density at day 5 post-GCI.
Chemical Information
-
CAS No. 149146-12-3
-
Appearance Solid
-
Molecular Weight 3651.95
-
Formula C159H252N40O58
-
Color White to off-white
-
Sequence
Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln
-
Sequence Shortening
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (27.38 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 5 mg/mL (1.37 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocols
-
Human pluripotent stem cell endothelial-cell differentiation
Human pluripotent stem cell endothelial differentiation is based on stepwise developmental patterning: early activation of WNT/GSK3β inhibition promotes mesodermal or vascular progenitor entry, followed by endothelial specification using VEGF-related signaling, BMP4, FGF2, Notch modulation, or cAMP depending on the published protocol. Endothelial differentiation is read out by acquisition of CD31, CD34, VE-cadherin/CD144, KDR/VEGFR2, vWF, Tie2, NOS3, acetylated LDL uptake, tube/network formation, barrier function, and in vivo vessel-forming capacity where tested.
-
Cell migration
Cell migration is a method that plays an important role in wound healing, cell differentiation, embryonic development, etc.
-
Cell differentiation
Cell differentiation refers to the process in which cells of the same origin gradually produce cell groups with different morphological structure and functional characteristics.
-
Apoptosis
Apoptosis, also called programmed cell death, is generally characterized by distinct morphological characteristics.
-
TUNEL staining for apoptotic DNA fragmentation
TUNEL staining detects DNA strand breaks by using terminal deoxynucleotidyl transferase to add labeled nucleotides to exposed 3′-OH DNA termini, generating either microscopic staining in fixed cells or tissue sections, or fluorescence/cytometric signal in cell suspensions. TUNEL positivity reflects DNA fragmentation but should not be interpreted alone as definitive apoptosis, because TUNEL can also label necrotic, autolytic, mechanically damaged, or DNA-repair-associated DNA breaks.
-
Chemotaxis Gradient Chamber Assay 1
The chemotaxis gradient chamber assay is based on the principle of observing directional cell migration in response to a stable, linear or quasi-linear concentration gradient of a chemoattractant formed between two fluid reservoirs separated by a narrow observation chamber. Cells placed within the chamber respond to the gradient by polarized movement toward higher chemoattractant concentrations, allowing quantification of chemotactic behavior in real time under microscopy. The classic Zigmond chamber design enables simultaneous visualization of gradient formation and individual cell trajectories, making it suitable for studying leukocyte chemotaxis and other motile cell types in vitro.
-
Under-Agarose Cell Migration Assay
The under-agarose cell migration assay is a classical in vitro chemotaxis method designed to evaluate directed cell movement through a semi-solid agarose matrix toward soluble chemoattractant gradients, enabling visualization and quantification of leukocyte or motile cell migration in a confined 2D-like environment. In this system, cells and chemoattractants are placed in separate wells cut into an agarose gel, allowing diffusion-driven gradient formation that guides directional migration, which is typically assessed by measuring migration distance, cell morphology changes, and accumulation toward the chemoattractant source. This assay has been widely used to study neutrophil and leukocyte chemotaxis as a simple alternative to filter-based migration systems and allows direct microscopic observation of migrating cells under near-physiological confinement conditions.
-
Transwell/Boyden Chamber Migration Assay
The Transwell/Boyden chamber migration assay measures cell movement through a porous membrane separating an upper and lower chamber, usually after a chemoattractant gradient is established by placing cells in the upper chamber and chemoattractant-containing medium in the lower chamber. The readout is generated by quantifying cells that traverse the membrane and appear on the lower membrane surface or in the lower chamber, depending on whether the cell type is adherent or non-adherent. This assay reflects chemotactic or haptotactic migration rather than matrix invasion unless an extracellular-matrix barrier is added to the membrane.
-
Endothelial Tube Formation Assay
Endothelial tube formation assay evaluates the ability of endothelial cells to attach, migrate, align, and organize into capillary-like networks when cultured on gelled basement membrane extract or Matrigel; the readout is the morphology and quantity of tube-like networks, which reflects an in vitro endothelial morphogenesis step related to angiogenesis. Basement membrane extract/Matrigel provides laminin-rich extracellular matrix cues that support endothelial differentiation into capillary-like structures, but it can contain biologically active growth factors, so growth-factor-reduced matrix is preferred when testing defined angiogenic stimulators or inhibitors.
-
Apoptosis Solutions
Apoptosis is a regulated, generally non-lytic cell-death pathway that removes unwanted, damaged, infected, or abnormal cells through coordinated morphological changes, caspase activation, DNA fragmentation, and membrane remodeling. The intrinsic apoptosis pathway is controlled mainly by mitochondrial outer membrane permeabilization, BCL-2 family proteins, cytochrome c release, apoptosome formation, caspase-9 activation, and downstream executioner caspase-3/7 activation. The extrinsic apoptosis pathway is initiated by death receptors such as Fas, TNFR, and TRAIL receptors, which recruit adaptor proteins and activate caspase-8 before engaging executioner caspases or mitochondrial amplification through BID cleavage. Apoptosis is linked to many phenotypes, including cancer cell killing, tissue homeostasis, immune regulation, neurodegeneration, infection response, and treatment-induced cytotoxicity; unresolved questions include how apoptosis interacts with necroptosis, pyroptosis, ferroptos
-
3D Collagen/Hydrogel Matrix Migration Assay
The 3D collagen/hydrogel matrix migration assay is based on embedding cells within or on top of a fibrillar collagen type I-rich three-dimensional matrix to model in vivo-like extracellular matrix (ECM) architecture, enabling analysis of cell migration through a physically and biochemically relevant scaffold. In contrast to 2D migration systems, cells in 3D matrices interact with fibrillar collagen networks, requiring coordinated adhesion remodeling and proteolytic or non-proteolytic deformation mechanisms to move through confined spaces, thereby providing a more physiologically relevant readout of invasive and migratory behavior in tissue-like environments. Cell movement in 3D collagen matrices is typically quantified by tracking single-cell trajectories, invasion depth, or matrix penetration over time, reflecting combined effects of cytoskeletal dynamics, cell-ECM adhesion turnover, and ECM remodeling. These systems are widely used to study tumor cell invasion and stromal cell motili
-
Cell-Exclusion Zone Migration Assay
The Cell-Exclusion Zone (CEZ) migration assay is an in vitro 2D cell migration method in which a defined cell-free area is created using removable physical barriers such as silicone stoppers, allowing cells to be seeded around the barrier and subsequently migrate into the cleared zone after barrier removal. This approach enables quantification of collective cell migration by monitoring repopulation of the initially cell-free region over time using microscopy-based imaging. Compared with scratch-based wound healing assays, barrier-based exclusion methods are designed to avoid mechanical damage to the extracellular matrix and reduce injury-induced effects on boundary cells, thereby improving interpretability of migration behavior in vitro. The assay readout is typically the progressive reduction in the cell-free area or the number of cells invading the exclusion zone, reflecting coordinated cell motility relevant to physiological processes such as wound healing, epithelial repair, and ca
-
Chemotaxis Gradient Chamber Assay 2
Chemotaxis gradient chamber assays measure directional cell migration in response to a soluble chemical gradient by imaging cells as they move across a defined observation region; the readout is generated from time-lapse cell trajectories, displacement toward the gradient, forward migration index, trajectory plots, rose/polar plots, and statistical tests of non-random directionality. The Dunn chamber is a direct-viewing glass chamber in which cells migrate across a bridge between control and chemoattractant wells, allowing observation of cells in a linear concentration gradient; related direct-viewing formats include the Insall chamber, which supports defined unidirectional gradients and high numerical-aperture microscopy, and the μ-Slide Chemotaxis chamber, which supports long-term live-cell imaging and gradient characterization with fluorescent dye.
-
Endothelial Cell Migration/Angiogenic Sprouting Assay
Endothelial cell migration and angiogenic sprouting assays are in vitro (and partially ex vivo-adapted) functional models that quantify the ability of endothelial cells to undergo coordinated migration, extracellular matrix invasion, and multicellular organization into capillary-like sprouts in response to pro-angiogenic stimuli such as VEGF, bFGF, or conditioned microenvironments. These assays are used to model early angiogenic events including tip-cell formation, directional migration, and lumen-like sprout extension, which collectively reflect angiogenic activation and vascular morphogenesis processes observed in vivo.
-
Pyroptosis Solutions
Pyroptosis is a lytic inflammatory cell-death pathway executed by gasdermin pores, most classically through inflammasome-mediated activation of caspase-1, cleavage of gasdermin D, membrane pore formation, LDH release, and secretion of IL-1β and IL-18. The canonical pathway is commonly modeled by priming cells with an inflammatory signal such as LPS to induce pro-IL-1β and inflammasome components, followed by an activation signal such as ATP or nigericin to activate NLRP3, ASC speck formation, caspase-1 cleavage, GSDMD cleavage, cytokine release, and pyroptotic membrane rupture. The non-canonical pathway is triggered when cytosolic LPS activates mouse caspase-11 or human caspase-4/5, leading to GSDMD cleavage and pyroptosis, and this can secondarily activate NLRP3-dependent IL-1β release. Pyroptosis is linked to inflammatory injury, infection, cancer, liver disease, ocular disease, placental inflammation, and other disease phenotypes, but unresolved questions include which gasdermin fam
-
Scratch/Wound-Healing Migration Assay
The scratch/wound-healing migration assay measures collective migration of adherent cells into an experimentally created cell-free gap in a confluent monolayer. The readout is generated by imaging the gap immediately after scratching and at later time points, then quantifying reduction in wound area, wound width, or percentage closure as cells move into the denuded region. Gap closure reflects cell migration but may also include cell proliferation, so interpretation should distinguish migration-focused conditions from proliferation-driven closure when possible, such as by using short assay windows, serum-controlled conditions, cell counting, or proliferation controls reported in published protocols.
-
Vascular/Branching Fractal Analysis
Vascular/branching fractal analysis quantifies the geometric complexity of vessel trees or vascular networks from segmented 2D images, commonly by converting vessels into binary and/or skeletonized maps and estimating fractal dimension using box-counting or related approaches. Fractal dimension is interpreted as an image-derived readout of vascular branching complexity, space filling, or density, and has been applied to retinal photographs, fluorescein angiography, OCT angiography, capillary perfusion maps, and in vitro Matrigel angiogenesis networks. The assay readout is generated from vessel-positive pixels after image preprocessing, vessel segmentation, binarization, and optional skeletonization; reported outputs include fractal dimension, vessel density, branchpoint density, endpoint density, vessel length density, tortuosity, and generation-based branching metrics when VESGEN-style analysis is used. The biological interpretation is limited to quantitative vascular patterning and s
-
Annexin V plus membrane-impermeant dye apoptosis staining
Annexin V-based apoptosis assays rely on the detection of phosphatidylserine (PS) externalization from the inner leaflet of the plasma membrane to the outer leaflet, an early biochemical hallmark of apoptosis. Fluorescently labeled Annexin V binds PS in a calcium-dependent manner, enabling identification of early apoptotic cells by flow cytometry or fluorescence microscopy. When combined with a membrane-impermeant DNA-binding dye (e. g. , propidium iodide), this approach allows discrimination between viable (Annexin V−/dye−), early apoptotic (Annexin V+/dye−), and late apoptotic or necrotic (Annexin V+/dye+) cell populations by assessing membrane integrity and PS exposure.
-
ROS/oxidative-stress fluorescent staining
ROS/oxidative-stress fluorescent staining uses cell-permeant fluorogenic probes that become fluorescent after oxidation inside cells or tissues; commonly used examples include DCFH-DA/DCFDA for broad cellular oxidant detection, DHE for superoxide-related signal detection, MitoSOX for mitochondrial superoxide-related signal detection, and CellROX probes for oxidative-stress-associated fluorescence readouts. The assay detects probe oxidation rather than a single ROS species unless the probe and analysis method have been chemically validated for that species. DCFH-DA enters cells, is deacetylated by intracellular esterases to DCFH, and produces fluorescent DCF after oxidation, so the readout is used as an operational measure of total cellular oxidative stress rather than a species-specific ROS measurement. DHE and MitoSOX can report superoxide-related oxidation, but red fluorescence alone can include non-specific ethidium-like oxidation products; HPLC or optimized spectral approaches are
-
Neural Crest/Neuronal Cell Migration Explant Assay
Neural crest (NC) and neuronal cell migration explant assays are in vitro systems in which neural tube-derived tissues are cultured to allow premigratory or newly emigrated neural crest cells to undergo epithelial-to-mesenchymal transition (EMT), migrate away from the explant, and form a measurable radial outgrowth that reflects migratory capacity and environmental responsiveness. These assays typically quantify migration by measuring the expansion of cell outgrowth from neural tube or neural plate border explants over time, often comparing early and later timepoints to derive a migration index such as a radius ratio, which reflects net cell dispersal from the explant core. Neural tube explant cultures preserve key aspects of neural crest behavior, including EMT, migration, and early differentiation, making them suitable for assessing intrinsic migratory ability and extrinsic cue dependence. However, studies emphasize that migratory outgrowth from neural tube explants may include non-n
-
Research Protocol for Cardiovascular Diseases
Cardiovascular disease can be modeled as maladaptive cardiac remodeling, where ischemic injury or pressure overload activates inflammatory signaling, fibroblast activation, extracellular-matrix deposition, cardiomyocyte hypertrophy, vascular remodeling, and progressive ventricular dysfunction. The TGF-β/SMAD axis is a central profibrotic pathway after myocardial injury and pressure overload, while innate immune and cytokine pathways regulate leukocyte recruitment, scar formation, and adverse remodeling. Key unresolved questions include which inflammatory signals are reparative versus harmful, when fibrosis is protective versus maladaptive, and whether pathway inhibition improves function without weakening necessary infarct healing or compensatory remodeling.
-
Research Protocol for Inflammation-related Diseases
The NLRP3 inflammasome is a cytosolic innate immune signaling platform that integrates priming signals and danger-signal activation to promote caspase-1 activation, maturation of IL-1β and IL-18, and gasdermin D-mediated pyroptotic cell death. The core experimental logic is to determine whether inflammatory disease phenotypes are driven by increased NLRP3 expression, ASC-containing inflammasome assembly, caspase-1 cleavage, GSDMD cleavage, and extracellular release of IL-1β/IL-18 rather than by nonspecific cell injury alone. The pathway is strongly linked to inflammation-related disease phenotypes because monosodium urate crystals activate NALP3/NLRP3 inflammasome signaling in gout-like crystal inflammation, cholesterol crystals activate NLRP3 inflammasomes in atherogenesis models, and DSS-induced intestinal inflammation has been reported to involve NLRP3 inflammasome activity. However, experimental colitis studies also show context-dependent protective effects of NLRP3 inflammasome co
-
Cardiac Morphometry
Cardiac morphometry is based on quantitative histological and stereological assessment of myocardial structure, including cardiomyocyte size, number, and extracellular matrix composition, to evaluate cardiac growth and remodeling under physiological or pathological conditions. Design-based stereology is considered a reference framework for obtaining unbiased estimates of structural parameters such as cardiomyocyte number, volume, and tissue architecture, enabling quantitative comparison across experimental groups. Histological image-based morphometry further enables measurement of cardiomyocyte cross-sectional area and collagen deposition using microscopy combined with image analysis software, allowing assessment of hypertrophy and fibrosis in cardiac remodeling models. These morphometric readouts reflect underlying biological processes such as cardiomyocyte hypertrophy, loss, or structural reorganization during disease progression or experimental stress.
-
Cell Viability Determination by MTT Colorimetric Assay
The following protocol uses the MTT colorimetric assay as a classic literature-established method for assessing cell viability/metabolic activity in cultured mammalian cells. MTT[3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] is reduced by metabolically active cells to a colored formazan product; the amount of formazan is quantified spectrophotometrically and provides an indirect measure of metabolically active viable cells. Importantly, MTT reduction reflects cellular oxidoreductase/metabolic activity rather than an absolute direct count of living cells, so changes in cellular metabolism can alter the signal independently of cell number.
-
SH-SY5Y neuronal-like differentiation
SH-SY5Y neuronal-like differentiation uses defined culture conditions to shift proliferative human neuroblastoma cells toward a neuron-like state, mainly assessed by reduced proliferation, neurite extension, neuronal-marker expression, and, in some protocols, increased dependence on neurotrophic support. Retinoic acid (RA) is commonly used for the first differentiation phase, and sequential RA followed by brain-derived neurotrophic factor (BDNF) in serum-free medium is a well-characterized approach for generating neuron-like SH-SY5Y cultures with extensive neurite outgrowth. The primary readouts are morphology-based neurite outgrowth and marker-based confirmation using proteins such as βIII-tubulin, MAP2, GAP43, synaptophysin, NeuN, NSE, TH, or related neuronal/synaptic markers, depending on the study endpoint.
Purity & Documentation
-
Data Sheet (283 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2738 mL | 1.3691 mL | 2.7383 mL | 6.8457 mL |
| DMSO | 5 mM | 0.0548 mL | 0.2738 mL | 0.5477 mL | 1.3691 mL |
| 10 mM | 0.0274 mL | 0.1369 mL | 0.2738 mL | 0.6846 mL | |
| 15 mM | 0.0183 mL | 0.0913 mL | 0.1826 mL | 0.4564 mL | |
| 20 mM | 0.0137 mL | 0.0685 mL | 0.1369 mL | 0.3423 mL | |
| 25 mM | 0.0110 mL | 0.0548 mL | 0.1095 mL | 0.2738 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.