1. Peptides
  2. Secretoneurin, rat

Secretoneurin, rat 

Cat. No.: HY-P1764
Handling Instructions

Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Secretoneurin, rat Chemical Structure

Secretoneurin, rat Chemical Structure

CAS No. : 149146-12-3

Size Stock
1 mg   Get quote  
5 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes[1].

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
Molecular Weight

3651.95

Formula

C₁₅₉H₂₅₂N₄₀O₅₈

CAS No.

149146-12-3

Sequence

{Thr}{Asn}{Glu}{Ile}{Val}{Glu}{Glu}{Gln}{Tyr}{Thr}{Pro}{Gln}{Ser}{Leu}{Ala}{Thr}{Leu}{Glu}{Ser}{Val}{Phe}{Gln}{Glu}{Leu}{Gly}{Lys}{Leu}{Thr}{Gly}{Pro}{Ser}{Asn}{Gln}

Sequence Shortening

TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Secretoneurin, rat
Cat. No.:
HY-P1764
Quantity:

Secretoneurin, rat

Cat. No.: HY-P1764