2. Gene
  3. GCGR - glucagon receptor Gene

GCGR - glucagon receptor Gene

  • Gene
  • Protein
  • Disease
  • Agent
  • Ortholog
Homo sapiens

Also known as GGR; GL-R; MVAH

Gene ID: 2642 | Gene type: protein coding

About GCGR

Cytogenetic location: 17q25.3 Genomic coordinates (GRCh38): 17:81,804,150-81,814,008 (from NCBI)

This gene has 6 transcripts (splice variants), 1 gene allele, 184 orthologues, 42 paralogues and is associated with 2 phenotypes. Biased expression in liver (RPKM 10.3), kidney (RPKM 5.0) and 1 other tissue.

Summary

The protein encoded by this gene is a Glucagon Receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).[provided by RefSeq, Jan 2010]

GCGR Products(4)

mRNA Protein Name
XM_006722277.2 XP_006722340.1 glucagon receptor isoform X1
NM_000160.5 NP_000151.1 glucagon receptor precursor
XM_011523539.2 XP_011521841.1 glucagon receptor isoform X3
XM_017024446.2 XP_016879935.1 glucagon receptor isoform X2

GCGR Protein Structure

HRM

HRM: Hormone receptor domain (56 - 122)

7tm_2

7tm_2: 7 transmembrane receptor (Secretin family) (139 - 396)

  • 0
  • 100
  • 200
  • 300
  • 400
  • 477 a.a.
Protein Preferred Names Protein Names

glucagon receptor

Recombinant GCGR Proteins

Cat. No. Product Name Accession Purity
HY-P700411 GCGR Protein, Human (HEK293, N-His, C-Myc) P47871 (A26-K136) ≥95%

Related Diseases

Diseases Alias
Endocrine Pancreas Disease

Disorder Of Endocrine Pancreas
Type 2 Diabetes Mellitus

Insulin Resistance

NIDDM

Diabetes Mellitus, Non-Insulin-Dependent

Type 2 Diabetes

T2D

Noninsulin-Dependent Diabetes Mellitus

Diabetes Mellitus, Type Ii

Maturity-Onset Diabetes

Insulin Resistance, Severe, Digenic

Diabetes Mellitus, Type 2

Diabetes Mellitus, Noninsulin-Dependent

Diabetes Mellitus, Noninsulin-Dependent, Association With

Diabetes Mellitus, Noninsulin-Dependent, Late Onset

Hypertension, Insulin Resistance-Related, Susceptibility To

Insulin Resistance, Susceptibility To

Non-Insulin-Dependent Diabetes Mellitus

Type Ii Diabetes Mellitus

Adult-Onset Diabetes Mellitus

Maturity-Onset Diabetes Mellitus

Diabetes Mellitus Type 2

Type Ii Diabetes

Type 2 Diabetes Mellitus, Susceptibility To

Diabetes, Type 2

Diabetes Mellitus, Noninsulin-Dependent, Susceptibility To

Diabetes Mellitus, Non-Insulin-Dependent, Susceptibility To

Diabetes Mellitus, Type 2, Susceptibility To

Diabetes Mellitus, Noninsulin-Dependent, 2

Diabetes Mellitus, Type Ii, Susceptibility To

Hypertension, Insulin Resistance-Related

Adult-Onset Diabetes

Aodm

Diabetes Mellitus, Adult-Onset

Diabetes Mellitus Type Ii

Diabetes Mellitus Type 2, Susceptibility To

Diabetes, Type Ii, Susceptibility To

Diabetes Type 2

Diabetes Mellitus

Adult Onset Diabetes

Maturity Onset Diabetes

Nonketotic Diabetes

Non-Insulin Dependent Diabetes Mellitus

T2dm - [Type 2 Diabetes Mellitus]

Niddm - [Non Insulin Dependent Diabetes Mellitus]

Dm2

Dm Type Ii

Diabetic Type 2

Insulin Requiring Type 2 Diabetes

Noninsulin Dependent Diabetes

Non-Insulin-Dependent Diabetes Mellitus Without Complications

Diabetes Due To Insulin Secretory Defect

Diabetes Mellitus Due To Insulin Secretory Defect

Non-Insulin-Dependent Diabetes Of The Young

Senile Diabetes

Nonketotic Hyperglycaemia

Stable Diabetes
Pheochromocytoma

Pheochromocytoma, Susceptibility To

Phaeochromocytoma

Adrenal Gland Chromaffin Paraganglioma

Adrenal Gland Chromaffinoma

Adrenal Gland Paraganglioma

Adrenal Gland Pheochromocytoma

Chromaffin Paraganglioma Of The Adrenal Gland

Intraadrenal Paraganglioma

PCC

Chromaffin Cell Tumor

Medullary Chromaffinoma

Medullary Paraganglioma

Pheochromoblastoma

Pheochromocytomas

Chromaffin Cell Neoplasm

Pheochromocytoma, Malignant
Hyperglycemia
Hypoglycemia

Hypoglycaemia

Low Blood Sugar

Hypoglycaemia Nos

Spontaneous Hypoglycaemia

Nondiabetic Hypoglycaemia

Hypoglycaemic Disorder Nos

Hypoglycaemic Syndrome
Epiphyseal Chondrodysplasia, Miura Type

ECDM

Tall Stature-Scoliosis-Macrodactyly Of The Great Toes Syndrome

Miura Type Epiphyseal Chondrodysplasia

Tall Stature-Scoliosis-Macrodactyly Of The Halluces Syndrome

Tall Stature-Long Halluces-Multiple Extra-Epiphyses Syndrome

Chondrodysplasia, Epiphyseal, Miura Type
Body Mass Index Quantitative Trait Locus 11

OBESITY

Obesity, Susceptibility To

Leanness, Inherited

Obesity, Susceptibility To, Bmiq11

Obesity, Mild, Early-Onset

Obesity, Association With

Obesity, Early-Onset, Susceptibility To

Obesity, Severe

Obesity, Severe, And Type Ii Diabetes

Obesity, Late-Onset

BMIQ11

Obesity Bmiq11

Obesity, Early-Onset

Obesity , Susceptibility To

Simple Obesity Nos

Excess Fat

Obesity, Not Elsewhere Classified, Body Mass Index Not Elsewhere Classified

Adiposis
Hypertension, Essential

Essential Hypertension

Hypertension

High Blood Pressure

Hypertension, Essential, Susceptibility To

Hypertensive Disease

Primary Hypertension

EHT

Hypertension, Salt-Sensitive Essential, Susceptibility To

Hyperpiesia

Idiopathic Hypertension

Hypertensive Disorder

Hypertension, Essential, Susceptibility To, 3

Hypertension, Essential 3

Hypertension, Essential, Salt-Sensitive

Hypertension, Essential, Susceptibility To, 6

Hypertension, Essential 6

Hypertension, Salt-Sensitive Essential

Hypertension, Susceptibility To

Hypertension, Essential, Susceptibility To, 4

Hypertension, Essential 4

Hypertension, Essential, Susceptibility To, 2

Hypertension, Essential 2

Hypertension, Essential, Susceptibility To, 1

Hypertension, Essential 1

Hypertension, Essential, Susceptibility To, 5

Hypertension, Essential 5

Htn

Vascular Hypertensive Disorder

Systemic Primary Arterial Hypertension

Hbp - [High Blood Pressure]

Systemic Arterial Hypertensive Disorder

Elevated Blood Pressure

Arterial Hypertension Nos

Hypertension Nos

Benign Hypertension

Systemic Arterial Hypertension

Systemic Hypertension

Artery Htn

Benign Htn

Vascular Htn

Vascular Hypertension

Cholesterol Hypertension

Cholesterol Htn

Idiopathic Htn

Malignant Hypertension

Malignant Htn

Raised Blood Pressure

Cardiovascular Hypertension

Primary Htn - [Hypertension]

High Arterial Tension

High Blood Pressure Disorder

Ht - [Hypertension]

Htn - [Hypertension]

Hypertensive Vascular Disease

Hypertensive Vascular Degeneration
Diabetes Mellitus

Diabetes
Prediabetes Syndrome

Impaired Glucose Tolerance

Prediabetes

Prediabetic State

IGT

Igt - [Impaired Glucose Tolerance]

Impaired Glucose Tolerance With Unspecified Complication

Impaired Glucose Tolerance Without Complication

Abnormal Glucose Tolerance
Mahvash Disease

Gcgr-Related Hyperglucagonemia

MVAH

Alpha-Cell Hyperplasia With Glucagonemia

Nesidioblastosis, Alpha Cell Hyperplasia, Microglucagonoma, And Nonfunctioning Islet Cell Tumor

Nesidioblastosis Alpha Cell Hyperplasia Microglucagonoma And Nonfunctioning Islet Cell Tumor
Diseases Alias
Waldenstroem'S Macroglobulinemia

Waldenstroem'S Macroglobulinemia

Waldenstroem'S Macroglobulinemia

Macroglobulinemia Of Waldenstrom

Lymphoplasmacytic Lymphoma With Igm Gammopathy

Lymphoplasmacytic Lymphoma

Waldenstroem'S Macroglobulinemia

Waldenstroem'S Macroglobulinemia

Macroglobulinemia Of Waldenstrom

Lymphoplasmacytic Lymphoma With Igm Gammopathy

Lymphoplasmacytic Lymphoma

Related Agents

Approval
Bioactive Molecules (7)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-114118 Semaglutide Agonist 99.84% Unkown
HY-13443 Exendin-4 Agonist 99.94% Yes
HY-P0014 Liraglutide Agonist 99.82% Unkown
HY-P0082 Glucagon (1-29), bovine, human 99.84% Unkown
HY-114118A Semaglutide TFA Agonist 99.92% Unkown
HY-P0119 Lixisenatide Agonist 99.93% Unkown
HY-P0119A Lixisenatide acetate Agonist 99.65% Unkown
Clinical Phase
Bioactive Molecules (24)
Cat. No. Product Name Effect
Purity Phase
HY-13443A Exendin-4 acetate Agonist 99.67% Phase 4
HY-P3463 Beinaglutide 99.74% Phase 4
HY-P3506 Retatrutide Agonist 99.89% Phase 3
HY-112185 Orforglipron Agonist 99.57% Phase 3
HY-P3506A Retatrutide TFA Agonist 99.31% Phase 3
HY-P3375 Mazdutide Agonist 99.74% Phase 3
HY-P2221B Glepaglutide acetate Agonist 98.47% Phase 3
HY-P0165 Taspoglutide Agonist 99.51% Phase 3
HY-P3366 Ecnoglutide Agonist 98.61% Phase 3
HY-P2221 Glepaglutide Agonist / Phase 3
HY-P3506B Retatrutide acetate Agonist / Phase 3
HY-P3375A Mazdutide TFA Agonist / Phase 3
HY-P0264 Exendin(9-39) amide Antagonist 99.81% Phase 2
HY-50663 MK 0893 Antagonist 99.86% Phase 2
HY-19904 Adomeglivant Antagonist 98.18% Phase 2
HY-P2231A Cotadutide acetate Agonist 96.37% Phase 2
HY-P4146 Survodutide Agonist 99.98% Phase 2
HY-19947 PF-06291874 Antagonist 99.18% Phase 2
HY-12525 LGD-6972 Antagonist ≥98.0% Phase 2
HY-P4146A Survodutide TFA Agonist 99.62% Phase 2
HY-P10018 Bamadutide Agonist / Phase 2
HY-P3498 Elsiglutide Agonist / Phase 2
HY-P2231 Cotadutide Agonist / Phase 2
HY-P10031 SAR441255 Agonist / Phase 1
Inhibitory Antibodies (2)
Cat. No. Product Name Effect
Purity Phase
HY-P99383 Volagidemab Antagonist 98.43% Phase 2
HY-P99357 Crotedumab Inhibitor 96.61% Phase 1
Pre-clinical Phase
Bioactive Molecules (94)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P0055 GLP-1(7-37) 99.82% Unkown
HY-P0054 GLP-1(7-36), amide acetate 96.58% Unkown
HY-P0055A GLP-1(7-37) acetate 99.63% Unkown
HY-103546 BETP Agonist 99.28% Unkown
HY-10930 UNC0321 Inhibitor 99.80% Unkown
HY-101116 GLP-1R Antagonist 1 Antagonist 99.84% Unkown
HY-P1141 GLP-1(9-36)amide Antagonist 99.78% Unkown
HY-125824 Danuglipron Agonist 98.63% Unkown
HY-P1024 GLP-2(1-33)(human) Agonist 98.73% Unkown
HY-P1144 Oxyntomodulin (bovine, porcine) Agonist 99.91% Unkown
HY-153865 Lotiglipron Agonist 99.68% Unkown
HY-124622 NNC-0640 Modulator 98.10% Unkown
HY-121835 GLP-1R agonist 2 Agonist 98.76% Unkown
HY-P0054B GLP-1(7-36), amide TFA 98.04% Unkown
HY-P2625 GLP-2(3-33) Agonist 99.88% Unkown
HY-103547 L-168049 Antagonist 99.93% Unkown
HY-P1348 GLP-1 moiety from Dulaglutide 95.02% Unkown
HY-50159 Glucagon receptor antagonists-3 Antagonist 98.52% Unkown
HY-N0630 Shanzhiside methyl ester Agonist 99.32% Unkown
HY-P3291 Dapiglutide Agonist 96.01% Unkown
HY-116819A VU0453379 hydrochloride Modulator ≥99.0% Unkown
HY-50158 Glucagon receptor antagonists-2 Antagonist 98.93% Unkown
HY-141839 GLP-1R modulator C16 Modulator 99.60% Unkown
HY-112679 GLP-1 receptor agonist 2 Agonist 98.70% Unkown
HY-142162 LSN3318839 Modulator 99.81% Unkown
HY-141842 GLP-1R modulator L7-028 Modulator 98.77% Unkown
HY-P1145A Glucagon-like peptide 1 (1-37), human TFA Agonist 95.21% Unkown
HY-129658A TT-OAD2 Agonist 99.59% Unkown
HY-141840 GLP-1R modulator C5 Modulator 99.60% Unkown
HY-P0150 Glucagon (19-29), human Inhibitor 98.15% Unkown
HY-50675 GRA Ex-25 Inhibitor 98.59% Unkown
HY-P1143A [Des-His1,Glu9]-Glucagon amide TFA Antagonist 99.62% Unkown
HY-P3102 GLP-1(32-36)amide 98.42% Unkown
HY-P3101 GLP-1(28-36)amide 98.79% Unkown
HY-144035 GLP-1R agonist 4 Agonist 98.26% Unkown
HY-P1160 Bay 55-9837 Agonist 99.08% Unkown
HY-148844 GCGR antagonist 2 Antagonist 99.76% Unkown
HY-116819 VU0453379 Modulator ≥98.0% Unkown
HY-P2497 Exendin (5-39) Antagonist 99.81% Unkown
HY-P1231 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 99.03% Unkown
HY-P1226 HAEGTFTSD Agonist 98.48% Unkown
HY-P1224 HAEGTFTSDVS 98.31% Unkown
HY-144034 GLP-1R agonist 3 Agonist 99.15% Unkown
HY-119739 Skyrin Antagonist / Unkown
HY-147622 GLP-1R agonist 9 Agonist / Unkown
HY-10036 Glucagon receptor antagonists-1 Antagonist 98.65% Unkown
HY-112185A Orforglipron hemicalcium hydrate Agonist / Unkown
HY-P0054A GLP-1(7-36), amide Agonist / Unkown
HY-145412 GLP-1 receptor agonist 7 98.41% Unkown
HY-P10032A NN1177 TFA Agonist / Unkown
HY-P1228 HAEGTFT 99.63% Unkown
HY-P5815A GLP-1 (1-36) amide (human, rat) (TFA) 98.81% Unkown
HY-P1229 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 98.01% Unkown
HY-P1223 Exendin-3/4 (59-86) 98.19% Unkown
HY-P1225 {Val1}-Exendin-3/4 99.45% Unkown
HY-N2452 Cochinchinenin C Agonist / Unkown
HY-145458 GLP-1 receptor agonist 9 Agonist / Unkown
HY-138996 GLP-1 receptor agonist 8 Agonist / Unkown
HY-128781 Glucagon receptor antagonists-5 Antagonist / Unkown
HY-P1145 Glucagon-like peptide 1 (1-37), human Agonist / Unkown
HY-P5578 A8SGLP-1 Agonist / Unkown
HY-P10019 Pegsebrenatide Agonist / Unkown
HY-P1141A GLP-1(9-36)amide TFA Antagonist / Unkown
HY-P0212A Neuropeptide Y, porcine TFA / Unkown
HY-144135 GLP-1R agonist 7 Agonist / Unkown
HY-P3542 Des His1, Glu8 Exendin-4 Antagonist / Unkown
HY-P5161A FC382K10W15 TFA Agonist / Unkown
HY-P1143 [Des-His1,Glu9]-Glucagon amide Antagonist / Unkown
HY-P3539 Exendin-4 (3-39) / Unkown
HY-P5074 GRPP (human) Agonist / Unkown
HY-124803 GPCR modulator-1 Modulator / Unkown
HY-144134 GLP-1R agonist 6 Agonist / Unkown
HY-P3622 (Ser8)-GLP-1 (7-36) amide, human Agonist / Unkown
HY-P3616 Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide / Unkown
HY-129656 GLP-1 receptor agonist 3 Agonist / Unkown
HY-P10032 NN1177 Agonist / Unkown
HY-144136 GLP-1R agonist 8 Agonist / Unkown
HY-P4672 (Met(O)27)-Glucagon (1-29) (human, rat, porcine) / Unkown
HY-P5815 GLP-1 (1-36) amide (human, rat) / Unkown
HY-P1144A Oxyntomodulin (bovine, porcine) (TFA) Agonist / Unkown
HY-153476 GIP/GLP-1 dual receptor agonist-1 Agonist / Unkown
HY-144033 GLP-1R agonist 1 Agonist / Unkown
HY-129658 TT-OAD2 free base Agonist / Unkown
HY-P3102A GLP-1(32-36)amide TFA / Unkown
HY-148212 GLP-1R agonist 17 Agonist / Unkown
HY-P1160A Bay 55-9837 TFA / Unkown
HY-P0082A Glucagon (1-29), bovine, human hydrochloride / Unkown
HY-144133 GLP-1R agonist 5 Agonist / Unkown
HY-P3621 Biotinyl-Glucagon (1-29), human, bovine, porcine / Unkown
HY-129657 GLP-1 receptor agonist 4 Agonist / Unkown
HY-P3101A GLP-1(28-36)amide TFA / Unkown
HY-P3388 Utreglutide Agonist 98.42% Unkown
HY-P3608 [Des-His1,Glu9] Glucagon Antagonist / Unkown
HY-P5578A A8SGLP-1 TFA Agonist / Unkown
Inhibitory Antibodies (1)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P990013 Gulgafafusp alfa Inhibitor / Unkown

Orthologs Information

Species Symbol Source ID
Felis catus GCGR VGNC VGNC:62492
Bos taurus GCGR VGNC VGNC:29285
Canis familiaris GCGR VGNC VGNC:41144
Rattus norvegicus GCGR RGD RGD:2669
Macaca mulatta GCGR VGNC VGNC:72899
Mus musculus GCGR MGD MGI:99572
Others GCGR NCBI