Topics

Erebosis: A Newly Described Cell-Death Phenomenon

Cell Programmed Death Cell Death & Disease Cellular Degeneration Proteostasis

Erebosis describes a cell-death-like state discovered during homeostatic replacement of enterocytes in the adult Drosophila intestine. Researchers identified scattered cells that progressively lost major cellular components, accumulated the angiotensin-converting-enzyme homolog Ance, and displayed flattened nuclei that became difficult to detect. These cells lacked the defining patterns reported for apoptosis, necrosis, or autophagic cell death, and blocking apoptosis did not prevent either enterocyte turnover or the appearance of the phenotype. The finding expanded a long history of classifying death by morphology and mechanism, but its current evidentiary boundary is narrow: erebosis is established as a reproducible phenomenon in one invertebrate tissue, not as a universal metazoan death program. Interest centers on whether it explains epithelial renewal that conventional apoptosis markers fail to capture and whether similarly inconspicuous cells have escaped detection in other rapidly renewing tissues[1][2][3].

The observed sequence differs from an execution pathway with a known molecular switch. Erebotic enterocytes lose cytoskeletal proteins, junctional components, organelles, and commonly used fluorescent reporters while retaining an Ance-rich remnant before disappearance. The original study did not identify a dedicated initiator, protease, pore-forming protein, or metabolic lesion that is necessary and sufficient for this process. Ance therefore functions as a useful marker in the reported model, not a proven executioner, and the absence of canonical apoptotic, necrotic, or autophagic features does not by itself establish an independent biochemical mechanism. A mechanistic definition will require perturbations that prevent the entire temporal phenotype without merely delaying tissue clearance. It must also separate active dismantling within the enterocyte from extrusion, digestion, or replacement imposed by neighboring epithelial and progenitor cells[1][2][3].

The strongest biological application is the study of intestinal homeostasis. Erebosis offers a testable explanation for how mature enterocytes can be removed without the conspicuous caspase activation and fragmentation expected from classical apoptosis, linking cell loss to epithelial replacement while preserving barrier organization. It may also improve experimental accounting: studies that count only apoptotic corpses could underestimate turnover if dying cells rapidly lose the reporters used to identify them. A later exploratory study detected ACE2-associated, erebosis-like neuronal profiles in aged mouse brain, an Alzheimer’s disease model, and human Alzheimer’s disease tissue, but it presented these observations as evidence that neuronal erebosis may exist rather than proof of a conserved pathway. No drug-discovery program can yet claim selective induction or inhibition of erebosis, because neither a validated mammalian assay nor a causal therapeutic target exists[1][4].

The principal gap is causal identity. Investigators need live lineage tracing from a healthy enterocyte through component loss to removal, genetic screens for indispensable regulators, ultrastructural and metabolic measurements, and rescue experiments that distinguish erebosis from stressed, extruding, or partially degraded cells. Cross-species studies should test orthologous markers without treating Ance or ACE2 staining as diagnostic on its own. Standard criteria should specify kinetics, membrane integrity, nuclear fate, organelle loss, clearance, and the interventions that suppress the process; comparison with apoptosis, necroptosis, ferroptosis, and lysosome-dependent death should use the same tissue and time window. Until such evidence emerges, erebosis is most valuable as a disciplined research question: it exposes blind spots in cell-death detection and epithelial turnover while warning against turning a distinctive morphology into a mechanistically complete or clinically actionable modality[1][2][3][4].

Articles

All
  • All
  • Scientific Reviews
  • EDM
  • Blog
Most Recent
  • Most Recent
  • Oldest

Products

All
  • All
  • Inhibitors & Agonists
  • Isotope-Labeled Compounds
  • Fluorescent Dye
  • Peptides
  • Recombinant Proteins
  • Antibodies
  • Screening Libraries
  • Inhibitory Antibodies
  • Reference Standards
  • GMP Small Molecules
  • Natural Products
Cat. No. Product Name Information Application Publication
HY-L052 Anti-COVID-19 Compound Library
COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs. Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,380 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Disease Focused Libraries

90
HY-L017 Stem Cell Signaling Compound Library
Adult stem cells are important for tissue homeostasis and regeneration due to their ability to self-renew and generate multiple types of differentiated daughters. Self-renewal is reflected by their capacity to undergo multiple/limitless divisions. Several signaling pathways are involved in self-renewal of stem cells, that is, Notch, Wnt, and Hedgehog pathways or Polycomb family proteins. Recent studies mainly focus on cancer stem cell (CSCs), induced pluripotent stem cell (iPSCs), neural stem cell and maintenance of embryonic stem cell pluripotency. Among them, CSCs have been believed to be responsible for tumor initiation, growth, and recurrence that have implications for cancer therapy. MCE owns a unique collection of 2,931 compounds that can be used for stem cell regulatory and signaling pathway research.

Signaling Pathway Targeting Libraries

86
HY-L146 Metabolic Enzyme Compound Library
Metabolism is the set of life-sustaining chemical reactions in organisms that maintain cell homeostasis. Metabolic pathways are enzyme-mediated biochemical reactions that lead to biosynthesis (anabolism) or breakdown (catabolism) of molecules including glucose metabolism, lipid metabolism and amino acid or protein metabolism within a cell or tissue. As catalysts, enzymes are crucial to metabolism as they allow a reaction to proceed more rapidly and tregulate the rate of a metabolic reaction. Due to the importance of metabolic balance in the organism, the abnormal function of metabolic enzymes often leads to the occurrence of a variety of metabolic diseases, such as diabetes, obesity, cardiovascular disease, etc. MCE designs a unique collection of 4,407 metabolic enzymes related small molecules, which is an important tool for studying the metabolic activities of organisms and developing drugs for metabolic diseases.

Signaling Pathway Targeting Libraries

84
HY-L045 Oxygen Sensing Compound Library
Oxygen homeostasis regulation is the most fundamental cellular process for adjusting physiological oxygen variations, and its irregularity leads to various human diseases, including cancer. Hypoxia is closely associated with cancer development, and hypoxia/oxygen-sensing signaling plays critical roles in the modulation of cancer progression. Hypoxia-inducible factor 1 (HIF-1) is a transcription factor that functions as a master regulator of oxygen homeostasis. A variety of HF-1 target genes have been identified thus far which encode proteins that play key roles in critical developmental and physiological processes including angiogenesis/vascular remodeling, erythropoiesis, glucose transport, glycolysis, iron transport, and cell proliferation/survival. HIF-1 is a heterodimeric transcription factor consisting of a constitutively expressed β-subunit and an oxygen-regulated α-subunit. The unique feature of HIF-1 is the regulation of HIF-1α expression and activity based upon the cellular O2 concentration. Under normoxic conditions, hydroxylation of HIF-1α on these different proline residues is essential for HIF proteolytic degradation by promoting interaction with the von Hippel-Lindau tumor-suppressor protein (pVHL) through hydrogen bonding to the hydroxyproline-binding pocket in the pVHL β-domain. As oxygen levels decrease, hydroxylation of HIF decreases; HIF-1α then no longer binds pVHL, and becomes stabilized, allowing more of the protein to translocate to the cell’s nucleus, where it acts as a transcription factor, upregulating (often within minutes) the production of proteins that stimulate blood perfusion in tissues and thus tissue oxygenation. MCE offers a unique collection of 4,317 oxygen sensing related compounds targeting HIF/HIF Prolyl-Hydroxylase, MAPK/ERK, PI3K/AKT signaling pathways, etc. MCE Oxygen Sensing Compound Library is a useful tool to study hypoxia, oxidative stress and discover new anti-cancer drugs.

Signaling Pathway Targeting Libraries

83
HY-L174 Macrophage Related Compound Library
Macrophages are effector cells of the innate immune system, engulfing bacteria and secreting pro-inflammatory and antibacterial mediators. They are an important component of the first line defense against pathogens and tumor cells. In addition, macrophages play an important role in eliminating damaged cells through programmed cell death. Like all immune cells, macrophages originate from pluripotent hematopoietic stem cells in the bone marrow. Macrophages play key functions in many physiological processes beyond homeostasis and innate immunity, including metabolic function, cell debris clearance, tissue repair, and remodeling. In order to fulfill their different functional roles, macrophages can polarize into a series of phenotypes, including classic (pro inflammatory, M1) and alternative (anti-inflammatory, healing promoting, M2) activation states, as well as a wide range of regulatory phenotypes and subtypes. Macrophages exist in all vertebrate tissues and have a dual function in host protection and tissue damage, maintaining a good balance. MCE designs a unique collection of 276 macrophage related compounds. It is a good tool to be used for research on Inflammation, cancer and other diseases.

Compound Characteristic Classified Libraries

83
HY-14393 Emodin
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice.
SARS-CoV   Casein Kinase   Autophagy   11β-HSD  
Cancer   Viral Infection   Glucose Metabolism   Obesity  
42
HY-13771 Ursodeoxycholic acid
Ursodeoxycholic acid (Ursodeoxycholate) is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection. Orally active.
G protein-coupled Bile Acid Receptor 1   FXR   Angiotensin-converting Enzyme (ACE)   Endogenous Metabolite  
Cancer   SARS-CoV-2 Infection  
32
HY-19414 MLN-4760
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
Angiotensin-converting Enzyme (ACE)  
Hypertension   Obesity  
25
HY-B0368 Captopril
Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM.
Angiotensin-converting Enzyme (ACE)  
Cancer   Viral Infection   Glucose Metabolism   SARS-CoV-2 Infection   Hypertension  
23
HY-12403 Talfirastide
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity .
Angiotensin Receptor   Angiotensin-converting Enzyme (ACE)  
Inflammation or Immune System Disease   Hypertension  
18
HY-12404 Diminazene aceturate
Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties.
Parasite   Angiotensin-converting Enzyme (ACE)  
Inflammation or Immune System Disease   Parasitic Infection  
14
HY-B0331A Enalapril maleate
Enalapril maleate (MK-421 maleate) is an orally active angiotensin-converting enzyme inhibitor. Enalapril maleate blocks the conversion of angiotensin I to angiotensin II, regulates the renin-angiotensin system, reduces preload and afterload, and decreases plasma angiotensin II levels. Enalapril maleate inhibits apoptosis, reduces nitric oxide metabolite levels, stabilizes endothelial cells, enhances endothelial antioxidant defense, scavenges reactive oxygen species (ROS), and alleviates neuronal damage. Enalapril maleate attenuates glutathione depletion, protein/lipid oxidation, tissue damage, and type III collagen immunolabeling in organs of diabetic rats. Enalapril maleate reduces systolic blood pressure and urinary albumin excretion, and delays the progression of diabetic cardiac/renal injury. Enalapril maleate is used in research related to asymptomatic left ventricular dysfunction, congestive heart failure, Alzheimer's disease, diabetes mellitus, acute myocardial infarction, atrial fibrillation, hypertension, cerebral ischemia, chronic heart failure, and single-ventricle physiology.
Angiotensin-converting Enzyme (ACE)   Apoptosis   Reactive Oxygen Species (ROS)  
Cerebrovascular Disease   Glucose Metabolism   Alzheimer's Disease   Hypertension   Myocardial Infarction   Heart Failure   Atrial Fibrillation  
13
HY-B0331 Enalapril
Enalapril (MK-421) is an orally active angiotensin-converting enzyme inhibitor. Enalapril blocks the conversion of angiotensin I to angiotensin II, regulates the renin-angiotensin system, reduces preload and afterload, and decreases plasma angiotensin II levels. Enalapril inhibits apoptosis, reduces nitric oxide metabolite levels, stabilizes endothelial cells, enhances endothelial antioxidant defense, scavenges reactive oxygen species (ROS), and alleviates neuronal damage. Enalapril attenuates glutathione depletion, protein/lipid oxidation, tissue damage, and type III collagen immunolabeling in organs of diabetic rats. Enalapril reduces systolic blood pressure and urinary albumin excretion, and delays the progression of diabetic cardiac/renal injury. Enalapril is used in research related to asymptomatic left ventricular dysfunction, congestive heart failure, Alzheimer's disease, diabetes mellitus, acute myocardial infarction, atrial fibrillation, hypertension, cerebral ischemia, chronic heart failure, and single-ventricle physiology.
Angiotensin-converting Enzyme (ACE)   Apoptosis   Reactive Oxygen Species (ROS)  
Cerebrovascular Disease   Glucose Metabolism   Alzheimer's Disease   Hypertension   Myocardial Infarction   Heart Failure   Atrial Fibrillation  
13
HY-110066 (Z)-Guggulsterone
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis. (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces ACE2 expression and SARS-CoV-2 infection.
Apoptosis   VEGFR   Akt   Angiotensin-converting Enzyme (ACE)   SARS-CoV   FXR  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Viral Infection   Pain   Digestive System Inflammation   Hypertension   Obesity   Lung Fibrosis  
8
HY-N9933 Tauro-β-muricholic acid
Tauro-β-muricholic acid (TβMCA) is an orally active trihydroxylated bile acid and a competitive, reversible FXR antagonist (IC50=40 μM). Tauro-β-muricholic acid inhibits bile acid-induced hepatocyte apoptosis by maintaining mitochondrial membrane potential, while simultaneously inhibiting intestinal FXR signaling, affecting bile acid synthesis, hepatic lipid metabolism, and insulin sensitivity. Accumulation of tauro-β-muricholic acid disrupts metabolic homeostasis, promoting cancer stem cell proliferation and tumor progression. The mechanisms of tauro-β-muricholic acid involve two aspects: first, inhibiting the translocation of the pro-apoptotic protein Bax to mitochondria and maintaining mitochondrial membrane potential (MMP); and second, blocking the FXR signaling pathway to regulate bile acid metabolism, reduce serum ceramide production, and downregulate the hepatic SREBP1C/CIDEA pathway. Tauro-β-muricholic acid possesses anti-hepatocyte apoptosis, bile acid homeostasis regulation, and liver fat accumulation reduction properties, and also functions as a biomarker, making it useful in the study of diseases such as bile acid metabolism disorders, non-alcoholic fatty liver disease, colorectal cancer, and liver fibrosis.

Source: rat

FXR   Apoptosis  
Cancer   Digestive System Disease   Neurodegenerative Disease   Digestive System Inflammation   Obesity  
6
HY-18206 Lisinopril
Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.
Angiotensin-converting Enzyme (ACE)  
Lung Cancer   Breast Cancer   Viral Infection   Glucose Metabolism   Hypertension  
6
HY-P2222A DX600 TFA
DX600 TFA is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 TFA exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity.
Angiotensin-converting Enzyme (ACE)  
Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
4
HY-P2222 DX600
DX600 is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity.
Angiotensin-converting Enzyme (ACE)  
Blood or Cardio-cerebrovascular Disease  
4
HY-N0237 Atractyloside A
Atractyloside A is an orally active inhibitor of the TLR4/MyD88/NF-κB signaling pathway and also an opener of the mitochondrial permeability transition pore (MPTP). Atractyloside A interferes with the activation of the TLR4/MyD88/NF-κB pathway, thereby inhibiting intestinal inflammatory responses. Atractyloside A reverses mucin synthesis impairment, improves intestinal barrier integrity, and restores homeostasis by altering the composition of the gut microbiota. Atractyloside A can be used in studies related to spleen deficiency diarrhea and myocardial injury.
Toll-like Receptor (TLR)   MyD88   NF-κB   Mitochondrial Metabolism   Interleukin Related   Aquaporin  
Inflammation or Immune System Disease   Metabolic or Endocrine Disease   Cardiovascular Disease  
3
HY-N0639 Punicalin
Punicalin is a species that can be isolated from the leaves of Punica granatum. Punicalin is an active molecule against hepatitis b virus (HBV). Punicalin can induce pyroptosis. Punicalin is a Carbonic anhydrase inhibitor. Punicalin blocks the binding of S-glycoprotein and ACE2 receptors. Pnuicalin has anti-inflammatory, antioxidant and antiviral activity.
HBV   Pyroptosis   Carbonic Anhydrase  
Infection   Inflammation or Immune System Disease  
3
HY-W010991 N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a specific substrate of angiotensin converting enzyme (ACE) with a Ki of 2.546×10-4 M. It is used as a chromogenic probe for quantitative detection of ACE activity. N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly can be hydrolyzed by ACE to generate N-[3-(2-furyl)acryloyl]-Phe (FAP) and Gly-Gly, and the ACE inhibitory effect is monitored by photometry. FAPGG competitively binds to the active center of ACE and is a key tool for screening ACE inhibitors such as Captopril (HY-B0368) and Dioscorin. Its reversible mechanism of action supports hypertension research and drug development targeting the renin-angiotensin system.
Angiotensin-converting Enzyme (ACE)  
3
HY-111956A D-Ala-Lys-AMCA TFA
D-Ala-Lys-AMCA TFA is a known proton-coupled oligopeptide transporter 1 (PEPT1) substrate that emits blue fluorescence. D-Ala-Lys-AMCA TFA may be transported into liver cancer cells and Caco-2 cells based on fluorescence analysis. D-Ala-Lys-AMCA TFA can be used for characterizing PEPT1-specific substrates or inhibitors (Ex/Em = 390/480 nm).
Fluorescent Dye  
Cancer  
2
HY-111956 D-Ala-Lys-AMCA
D-Ala-Lys-AMCA is a known proton-coupled oligopeptide transporter 1 (PEPT1) substrate that emits blue fluorescence. D-Ala-Lys-AMCA may be transported into liver cancer cells and Caco-2 cells based on fluorescence analysis. D-Ala-Lys-AMCA can be used for characterizing PEPT1-specific substrates or inhibitors (Ex/Em = 390/480 nm).
Fluorescent Dye  
Cancer  
2
HY-N0887 Isoastragaloside I
Isoastragaloside I is a natural compound found in Astragalus membranaceus, with oral activity and multiple biological activities such as anti-inflammatory and antioxidant properties. Isoastragaloside I inhibits Akt, NF-κB, MAPKs and PI3K, enhances the activity of hepatic FXR, regulates the TGF-β/Smads signaling pathway, and upregulates antioxidant molecules downstream of Nrf2. Isoastragaloside I inhibits the expression of NO, TNF-α, iNOS, COX-2, IL-1β and VCAM-1, and reduces intracellular ROS levels. Isoastragaloside I attenuates blood-brain barrier disruption, restores intestinal barrier function, increases β-cell mass, improves glucose homeostasis, and elevates circulating adiponectin levels. Isoastragaloside I can be used for the study of neuroinflammation-related neurodegenerative diseases, cholestatic liver disease, and diabetes.
Akt   NF-κB   p38 MAPK   PI3K   FXR   Keap1-Nrf2   NO Synthase   COX   Interleukin Related   Integrin   TGF-β Receptor   Reactive Oxygen Species (ROS)  
Neurodegenerative Disease   CNS Infection   Liver Disease   Type 1 Diabetes  
2
HY-P2536 Mca-Ala-Pro-Lys(Dnp)-OH
Mca-Ala-Pro-Lys(Dnp)-OH, a specific ACE2 quenched fluorogenic substrate, can be used to detect ACE2 activity, such as urinary, heart and lung.
Angiotensin-converting Enzyme (ACE)  
2
HY-111956B D-Ala-Lys-AMCA hydrochloride
D-Ala-Lys-AMCA hydrochloride is a known proton-coupled oligopeptide transporter 1 (PEPT1) substrate that emits blue fluorescence. D-Ala-Lys-AMCA hydrochloride may be transported into liver cancer cells and Caco-2 cells based on fluorescence analysis. D-Ala-Lys-AMCA hydrochloride can be used for characterizing PEPT1-specific substrates or inhibitors (Ex/Em = 390/480 nm).
Fluorescent Dye  
Cancer  
2
HY-P9801 Anti-Spike-RBD mAb
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment.
SARS-CoV  
1
HY-125130 Hesperetin 7-O-glucoside
Hesperetin 7-O-glucoside is a typical flavonoid monoglucoside, which is an anti-inflammatory agent and an antihypertensive with orally active. Hesperetin 7-O-glucoside is a commonly used food adjuvant. Hesperetin 7-O-glucoside inhibits human intestinal maltase and human HMG-CoA reductase with Ki of 1.8 mM and 9.8 μM, respectively. Hesperetin 7-O-glucoside has antibacterial activity and can regulate intestinal flora and metabolic homeostasis in mice.
HMG-CoA Reductase (HMGCR)   Bacterial   Interleukin Related  
Metabolic or Endocrine Disease   Digestive System Disease   Bacterial Infection   Digestive System Inflammation   Hypertension  
1
HY-113478S Ursodeoxycholic acid-d4
Ursodeoxycholic acid-2,2,4,4-d4 is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection.
Isotope-Labeled Compounds  
Metabolic or Endocrine Disease  
1
HY-N0468 Rebaudioside D
Rebaudioside D is an orally active sweetener that targets and activates FXR, modulates Acetyl-CoA Carboxylase, and inhibits 3-hydroxy-3-methylglutaryl-CoA reductase. Rebaudioside D regulates bile acid homeostasis and lipid metabolism, reduces the synthesis rates of fatty acids and cholesterol, and exerts multiple effects including anti-adipogenesis, hepatoprotection, anti-steatosis, gut microbiota modulation, enhancement of secondary bile acid metabolism, anti-endotoxin activity, regulation of bile acid transport, and inhibition of bile acid efflux. Rebaudioside D also reduces body weight gain, visceral fat accumulation, hepatic triglyceride and cholesterol accumulation, hepatic lipid peroxidation, and decreases the circulating level of lipopolysaccharide-binding protein. Rebaudioside D additionally enhances the secondary bile acid metabolic pathway of intestinal bacteria, upregulates the gene expression of ileal organic solute transporter α, and downregulates the gene expression of hepatic bile salt export pump. Rebaudioside D does not affect glucose homeostasis, alter total caloric intake or fecal energy excretion, induce weight gain, exacerbate obesity, promote hepatic steatosis, impair brown adipose tissue function, nor change skeletal muscle metabolism-related proteins. Rebaudioside D can be used in diet-induced obesity and obesity-related research.
FXR   Acetyl-CoA Carboxylase  
Obesity  
1
HY-Y1147 Diethyl maleate
Diethyl maleate (DEM) is an orally available, effective glutathione (GSH) depletor that crosses the blood-brain barrier. Diethyl maleate covalently binds irreversibly to GSH via glutathione S-transferase with an in vitro IC50 of 0.1-0.5 mM. Diethyl maleate selectively depletes GSH in liver, lung, and brain tissues, exacerbating oxidative stress and enhancing hyperbaric oxygen toxicity. Diethyl maleate promotes precursor amino acid uptake and in turn promotes GSH synthesis by upregulating the activity of the cystine-glutamate transporter XO-. Diethyl maleate can be used to study redox homeostasis and GSH protection mechanisms in oxidative stress-related diseases such as hyperbaric oxygen injury and metabolic diseases[1][2][3].
Biochemical Assay Reagents  
1
HY-P4855 CRAMP (mouse)
CRAMP (mouse) is an antibacterial peptide and a functional homolog of LL-37. CRAMP (mouse) exhibits potent antibacterial activity against Gram-negative bacteria. The complex formed by CRAMP (mouse) and CpG can activate macrophages to secrete TNF-α. CRAMP (mouse) plays a key role in wound healing, immune regulation and maintenance of intestinal homeostasis.
Bacterial   TNF Receptor  
Inflammation or Immune System Disease   Bacterial Infection  
1
HY-N0217 Benzoylaconine
Benzoylaconine (Benzoylaconitine) is an orally active monoester alkaloid found in the traditional Chinese medicine Aconitum carmichaelii. Benzoylaconine is an ACE2 agonist (EC50: 1.5 μM) with antihypertensive and anti-heart failure effects. Benzoylaconine inhibits TLR-induced MAPK and NF-κB pathways to exert anti-inflammatory effects. Benzoylaconine upregulates the protein levels of P-gp, MRP2, and has anti-tumor effects.
Angiotensin-converting Enzyme (ACE)   Reactive Oxygen Species (ROS)   Toll-like Receptor (TLR)   NF-κB   COX   NO Synthase   p38 MAPK   P-glycoprotein  
Lung Cancer   Breast Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Neurodegenerative Disease   Depression   Pain   Digestive System Inflammation   Hypertension   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
1
HY-143712 Allolithocholic acid
Allolithocholic acid is an orally active metabolite of Lithocholic acid (HY-B0172). Allolithocholic acid is a dual GPBAR1 agonist (EC50 = 2.7 μM) and RORγt inverse agonist (IC50 = 3.4 μM). Allolithocholic acid modulates immune and metabolic pathways, regulates immune cell polarization, prevents M1 macrophage and Th17 CD4 cell polarization. Allolithocholic acid improves insulin sensitivity, reduces liver lipid accumulation, reverses liver immunological, inflammatory and metabolic signaling dysregulation, restores bile acid homeostasis, adipose tissue histopathology/function, and intestinal microbiota composition, modulates intestinal immunity. Allolithocholic acid can be used for the researches of cancer, inflammayion, immunology and metabolic disease.
Drug Metabolite   G protein-coupled Bile Acid Receptor 1   ROR  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
1
HY-18719S Endoxifen-d5 (Z-isomer)
Endoxifen-d5 (Z-isomer) is the deuterated-labeled Endoxifen (Z-isomer methanesulfonate) (HY-18719H). Endoxifen-d5 Z-isomer is an orally active selective PKCβ1 inhibitor with an IC50 of 360 nM against human PKCβ1. It also acts as an estrogen receptor modulator and antiestrogen. Endoxifen-d5 Z-isomer binds to and blocks ERα, ERβ and PKCβ1, inhibits estrogen and PI3K/AKT/mTORC1 signaling pathways, suppresses the expression of genes associated with cell cycle, cell proliferation and extracellular matrix remodeling, and induces apoptosis, reactive oxygen species (ROS) production and hypoxic features. Endoxifen-d5 Z-isomer inhibits tumor growth in breast tumor and glioblastoma models, reduces bone turnover and blood lipid levels, and does not require metabolism via CYP2D6. It can be used in research related to ER+ breast cancer, invasive breast cancer, glioblastoma multiforme, type I bipolar disorder, desmoid tumor, gynecological malignancies, melanoma and hormone receptor-positive solid tumors
PKC   Estrogen Receptor/ERR   PI3K   Akt   mTOR   Apoptosis   Reactive Oxygen Species (ROS)  
Breast Cancer   Melanoma   Glioblastoma  
/
HY-14393S Emodin-d4
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice.
Isotope-Labeled Compounds   SARS-CoV   Casein Kinase   Autophagy   11β-HSD  
Cancer  
/
HY-144470S Dehydroindapamide-d3
Dehydroindapamide-d3 is the deuterium labeled Dehydroindapamide (HY-W420344). Dehydroindapamide is the indole form of Indapamide (HY-B0259). Dehydroindapamide standard can be used to quantitatively measure the Indapamide turnover rate by CYP3A4, which was approximately 10-fold higher than that of Indoline (HY-Y0788), and slightly enhanced affinity for CYP3A4.
Isotope-Labeled Compounds   Potassium Channel  
/
HY-P1841 Glucagon-Like Peptide (GLP) II, human
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
Endogenous Metabolite   Apoptosis  
Metabolic or Endocrine Disease  
/
HY-P11413 PAI-1
PAI-1 is a serine protease inhibitor (SERPIN). PAI-1 binds to and irreversibly inhibits uPA, tPA and furin; it also interacts with vitronectin, α1-acid glycoprotein, CRT, TLR4, proteasome α-3 subunit, uPAR, LRP1, Integrin αvβ3 and thrombin. PAI-1 regulates fibrinolysis, extracellular matrix turnover, cell migration, angiogenesis, inflammatory response and tissue remodeling; it mediates epithelial-mesenchymal transition (EMT)/endothelial-mesenchymal transition (EndMT), apoptosis and thrombus stabilization. PAI-1 can be used in research related to sepsis, acute lung injury, cardiovascular diseases, tissue fibrosis, diabetic nephropathy, obstructive nephropathy and non-insulin-dependent diabetes mellitus.
PAI-1   Serpin   Ser/Thr Protease   Furin   Toll-like Receptor (TLR)   LDLR   Integrin   Apoptosis  
Cardiovascular Disease   Type 1 Diabetes   Acute Lung Injury   Chronic Kidney Disease  
/
HY-B1842S1 Fluroxypyr-d2
Fluroxypyr-d2 is the deuterium labeled Fluroxypyr (HY-B1842). Fluroxypyr is an auxin herbicide to control annual or perennial weeds. Fluroxypyr icauses auxin overdose or excessive endogenous auxin concentrations, thereby resulting in an imbalance of auxin homeostasis and interaction with other hormones in tissues.
Isotope-Labeled Compounds   Herbicide  
/
HY-P990814 Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34)
Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) is a mouse-derived IgG1 κ type antibody inhibitor, targeting to SARS-CoV-2 S protein. Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) reacts with the receptor binding domain (RBD) epitope B in the spike (S) protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) can block the binding of the SARS-CoV-2 S protein to angiotensin-converting enzyme 2 (ACE2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) can be used for the research of SARS-CoV-2 infection.

Species: Virus

SARS-CoV  
SARS-CoV-2 Infection  
/
HY-149373 Garcinone B
Garcinone B, a xanthone derivative, is a nature product that could be isolated from the pericarp of Mangosteen. Garcinone B is a potent ACE2 and Mpro inhibitor. Garcinone B can be used in research of COVID-19.
Angiotensin-converting Enzyme (ACE)   SARS-CoV  
Infection  
/
HY-143712R Allolithocholic acid (Standard)
Allolithocholic acid (Standard) is the analytical standard of Allolithocholic acid (HY-143712). This product is intended for research and analytical applications. Allolithocholic acid is an orally active metabolite of Lithocholic acid (HY-B0172). Allolithocholic acid is a dual GPBAR1 agonist (EC50 = 2.7 μM) and RORγt inverse agonist (IC50 = 3.4 μM). Allolithocholic acid modulates immune and metabolic pathways, regulates immune cell polarization, prevents M1 macrophage and Th17 CD4 cell polarization. Allolithocholic acid improves insulin sensitivity, reduces liver lipid accumulation, reverses liver immunological, inflammatory and metabolic signaling dysregulation, restores bile acid homeostasis, adipose tissue histopathology/function, and intestinal microbiota composition, modulates intestinal immunity. Allolithocholic acid can be used for the researches of cancer, inflammayion, immunology and metabolic disease.
Reference Standards   Drug Metabolite   G protein-coupled Bile Acid Receptor 1   ROR  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P3258 SP-10
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research.
Cholinesterase (ChE)  
Infection  
/
HY-W768772 Fluroxypyr-13C2,d2
Fluroxypyr-13C2,d2 is the deuterium labeled and 13C-labeled Fluroxypyr (HY-B1842). Fluroxypyr is an auxin herbicide to control annual or perennial weeds. Fluroxypyr icauses auxin overdose or excessive endogenous auxin concentrations, thereby resulting in an imbalance of auxin homeostasis and interaction with other hormones in tissues.
Isotope-Labeled Compounds   Herbicide  
/
HY-P3740 Osteocalcin 30-43 Fragment
Osteocalcin 30-43 Fragment is an osteocalcin fragment.Osteocalcin 30-43 Fragment is a serum marker of bone turnover.
Biochemical Assay Reagents  
/
HY-P5827 SBP1 peptide
SBP1 peptide is a chemically synthesized 23-mer peptide fragment of the ACE2 PD α1 helix. SBP1 peptide associates with micromolar affinity to insect-derived SARS-CoV-2-RBD protein .
SARS-CoV   Angiotensin-converting Enzyme (ACE)  
Infection  
/
HY-P990815 Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01)
Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) is a mouse-derived IgG1 κ type antibody inhibitor, targeting to SARS-CoV-2 S protein. Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) reacts with the receptor binding domain (RBD) epitope A in the spike (S) protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) can block the binding of the SARS-CoV-2 S protein to angiotensin-converting enzyme 2 (ACE2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) can be used for the research of SARS-CoV-2 infection.

Species: Virus

SARS-CoV  
SARS-CoV-2 Infection  
/
HY-18102BS GLPG0492-13C,d3 racemate
GLPG0492-13C,d3 racemate is 13C-labeled GLPG0492 (racemate) (HY-18102B). GLPG0492 racemate is an orally active, non-steroidal selective androgen receptor modulator. GLPG0492 racemate exerts functional transactivation by binding to the ligand-binding domain of the receptor, exhibiting preferential partial agonist activity in muscle and bone tissues with low activity in reproductive tissues. GLPG0492 racemate effectively counteracts muscle atrophy-related pathways, significantly enhances muscle strength, maintains motor ability, reduces fibrosis and improves electrophysiological parameters. GLPG0492 racemate prevents immobilization-induced muscle atrophy and regulates muscle mass homeostasis, serving as a valuable tool compound for studies on Duchenne muscular dystrophy, muscle loss and various types of disuse musculoskeletal atrophy.
Isotope-Labeled Compounds   Adrenergic Receptor  
Neurological, Eye or Ear Disease  
/
HY-143712S1 Allolithocholic Acid-d4
Allolithocholic Acid-d4 (3α-hydoxy-5α-Cholaoic Acid-d4, allo-LCA-d4) is deuterium labeled Allolithocholic acid (HY-143712). Allolithocholic acid is an orally active metabolite of Lithocholic acid (HY-B0172). Allolithocholic acid is a dual GPBAR1 agonist (EC50 = 2.7 μM) and RORγt inverse agonist (IC50 = 3.4 μM). Allolithocholic acid modulates immune and metabolic pathways, regulates immune cell polarization, prevents M1 macrophage and Th17 CD4 cell polarization. Allolithocholic acid improves insulin sensitivity, reduces liver lipid accumulation, reverses liver immunological, inflammatory and metabolic signaling dysregulation, restores bile acid homeostasis, adipose tissue histopathology/function, and intestinal microbiota composition, modulates intestinal immunity. Allolithocholic acid can be used for the researches of cancer, inflammayion, immunology and metabolic disease.
Isotope-Labeled Compounds   Drug Metabolite   G protein-coupled Bile Acid Receptor 1   ROR  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P5377 Abz-HPGGPQ-EDDnp
Abz-HPGGPQ-EDDnp (Cathepsin K substrate) is a biological active peptide. (Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption. It has potential as a drug target in autoimmune diseases and osteoporosis.This FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids and cell lysates. Abz-HPGGPQ-EDDnp [where Abz represents o-aminobenzoic acid and EDDnp represents N -(2, 4-dinitrophenyl)-ethylenediamine], a substrate initially developed for trypanosomal enzymes, is efficiently cleaved at the Gly-Gly bond by cathepsin K. This peptide is resistant to hydrolysis by cathepsins B, F, H, L, S and V, Ex/Em=340 nm/420 nm.)
Ser/Thr Protease  
/
HY-P4610 H-Trp-Tyr-OH
H-Trp-Tyr-OH is an orally active tryptophan-tyrosine dipeptide with blood-brain barrier permeability. H-Trp-Tyr-OH exerts physiological regulatory effects by stimulating enteroendocrine cells to secrete glucagon-like peptide GLP-1. In mouse models of tauopathies, H-Trp-Tyr-OH inhibits tau phosphorylation, reduces the level of neurofibrillary tangles, increases dopamine turnover, upregulates synapsin expression, and elevates cecal short-chain fatty acid levels, thereby improving behavioral deficits and extending lifespan. H-Trp-Tyr-OH can be used in research related to impaired glucose tolerance and tauopathies.
GLP Receptor  
Glucose Metabolism  
/
HY-B0260S2 Methylprednisolone-d4
Methylprednisolone-d4 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels.
Isotope-Labeled Compounds   Glucocorticoid Receptor   Autophagy   SARS-CoV  
Cancer   Infection   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P990731 Canvircept
Canvircept is a recombinant fusion protein comprising an angiotensin-converting enzyme 2 (ACE2) fused to a human IgG1 Fc.
Angiotensin-converting Enzyme (ACE)  
Blood or Cardio-cerebrovascular Disease  
/
HY-P2616 Mca-YVADAP-Lys(Dnp)-OH
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2).
Caspase   Angiotensin-converting Enzyme (ACE)  
/
HY-B0590S3 Tetrabenazine-d7
Tetrabenazine-d7 (TBZ-d7-d7) is deuterium labeled Tetrabenazine (HY-B0590). Tetrabenazine (Ro 1-9569) is a brain-penetrant and orally active VMAT2-selective ligand with human VMAT2 Ki 100 nM. Tetrabenazine binds VMAT2 to block monoamine uptake into synaptic vesicles, potentiates cytoplasmic monoamine degradation. Tetrabenazine weakly blocks dopamine D2 receptors, and increases dopamine turnover via elevated cerebrospinal fluid homovanillic acid. Tetrabenazine can be used for the research of Huntington’s disease, tardive dyskinesia, and Tourette’s syndrome.
Isotope-Labeled Compounds   Monoamine Transporter   Dopamine Receptor  
Huntington's Disease  
/
HY-W704752 Z-Doxepin-d3 Hydrochloride
Z-Doxepin-d3 hydrochloride is the deuterium labeled 7-Hydroxychlorpromazine hydrochloride (HY-W704749). 7-Hydroxychlorpromazine hydrochloride is the active metabolite of Chlorpromazine (HY-12708). 7-Hydroxychlorpromazine hydrochloride can increase prolactin levels in rats. 7-Hydroxychlorpromazine hydrochloride can increase dopamine turnover and has a sedative effect. In addition, 7-Hydroxychlorpromazine hydrochloride can effectively inhibit amphetamine-induced stereotyped behavior in rats and is used in the study of psychosis.
Isotope-Labeled Compounds   Drug Metabolite   Dopamine Receptor  
Neurological, Eye or Ear Disease  
/
HY-B0926S Diatrizoic acid-d6
Diatrizoic acid-d6 (Diatrizoate-d6; Amidotrizoic acid-d6) is the deuterium labeled Diatrizoic acid (HY-B0926). Diatrizoic acid (Diatrizoate) is an iodinated radiocontrast agent and has the potential for radiographic imaging of the airways. Diatrizoic acid induces mitochondrial turnover and oxidative stress, and activating apoptosis by dysregulating calcium.
Isotope-Labeled Compounds   Apoptosis  
Inflammation or Immune System Disease  
/
HY-110066R (Z)-Guggulsterone (Standard)
(Z)-Guggulsterone (Standard) is the analytical standard of (Z)-Guggulsterone. This product is intended for research and analytical applications. (Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis. (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces ACE2 expression and SARS-CoV-2 infection.
Reference Standards   Apoptosis   VEGFR   Akt   Angiotensin-converting Enzyme (ACE)   SARS-CoV   FXR  
Cancer   SARS-CoV-2 Infection  
/
HY-15244G Alpelisib (GMP)
Alpelisib GMP is Alpelisib (HY-15244) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Alpelisib (BYL-719) is an orally active PI3Kα-selective inhibitor that blocks the conversion of PIP2 to PIP3, thereby inhibiting pathways including PI3K/AKT/mTOR, MAPK/ERK, Notch and JAK-STAT. Alpelisib also induces apoptosis, G0/G1 phase arrest and senescence; it significantly inhibits the proliferation, self-renewal, stemness and epithelial-mesenchymal transition (EMT) of tumor cells, reduces cancer stem cell populations and decreases the expression of stem cell markers. Alpelisib not only enhances the sensitivity to Eribulin (HY-13442) and exerts a synergistic effect with Paclitaxel (HY-B0015), but may also induce drug resistance by upregulating the SGK3/GSK3β/β-catenin signaling pathway. Alpelisib can be applied to research related to breast cancer, gastric cancer and lipomas associated with PTEN hamartoma tumor syndrome.
PI3K   Apoptosis  
/
HY-12299G WH-4-023 (GMP)
WH-4-023 GMP is WH-4-023 (HY-12299) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. WH-4-023 (Dual LCK/SRC inhibitor) is a Lck/Src dual target inhibitor with functions in stem cell maintenance and differentiation regulation. WH-4-023 blocks epithelial-mesenchymal transition, supports the self-renewal of porcine embryonic stem cells, and inhibits their differentiation into mesoderm and endoderm. WH-4-023 is a key component of 3i/LAF medium, and enables the stable establishment and long-term maintenance of porcine pre-gastrulation epiblast stem cell lines. Removal of WH-4-023 reduces the expression of pluripotency factors in porcine and human extended pluripotent stem cells. WH-4-023 can be applied to relevant studies such as non-small cell lung cancer resistant to EGFR-TKIs.
Src  
Non-Small Cell Lung Cancer  
/
HY-105801 Lydimycin
Lydimycin (α-DHB; α-Dehydrobiotin) is an antibiotic produced by Streptomyces lydicus, with antibacterial, antifungal and antiviral activities. Lydimycin inhibits the binding of SARS-CoV-2 S-614G spike protein to human ACE2. The antibacterial activity of Lydimycin can be reversed by Biotin (HY-B0511) in the culture medium. Lydimycin is applicable to infection-related research.

Source: Streptomyces lydicus

Antibiotic   Bacterial   Fungal   SARS-CoV  
Coronavirus Infection   Bacterial Infection   Fungal Infection  
/
HY-W012340R H-HomoArg-OH hydrochloride (Standard)
H-HomoArg-OH hydrochloride (Standard) is the analytical standard of H-HomoArg-OH hydrochloride (HY-W012340). This product is intended for research and analytical applications. H-HomoArg-OH hydrochloride (L-Homoarginine hydrochloride) is an orally active endogenous non-protein amino acid. H-HomoArg-OH hydrochloride acts as a weak alternative substrate for NOS and interferes with NO production, selectively inhibits tissue-nonspecific alkaline phosphatase (TNAP), and suppresses the uptake of arginine by y+-type transporters (system y+). H-HomoArg-OH hydrochloride increases tissue hArg concentrations in vivo, regulates amino acid homeostasis, and improves renal function and pathological features of diabetic nephropathy. H-HomoArg-OH hydrochloride can be used in studies related to diabetes and cardiomyopathy.
Reference Standards   Endogenous Metabolite   Monocarboxylate Transporter   Phosphatase  
Glucose Metabolism   Cardiomyopathy  
/
HY-N0639R Punicalin (Standard)
Punicalin (Standard) is the analytical standard of Punicalin. This product is intended for research and analytical applications. Punicalin is a species that can be isolated from the leaves of Punica granatum. Punicalin is an active molecule against hepatitis b virus (HBV). Punicalin can induce pyroptosis. Punicalin is a Carbonic anhydrase inhibitor. Punicalin blocks the binding of S-glycoprotein and ACE2 receptors. Pnuicalin has anti-inflammatory, antioxidant and antiviral activity.
Reference Standards   HBV   Pyroptosis   Carbonic Anhydrase  
Infection   Inflammation or Immune System Disease  
/
HY-P5407 HD5
HD5 is an innate immune effector peptide and SARS-CoV Inhibitor. HD5 binds to the ligand-binding domain of angiotensin-converting enzyme-2 (ACE2) via multiple hydrogen bonds to competitively block the receptor, shielding it from viral recognition. HD5 can be used for the research of COVID-19, HPV16 infection, epithelial ovarian cancer, small-cell lung cancer, and colon cancer.
SARS-CoV   Angiotensin-converting Enzyme (ACE)  
Colorectal Cancer   Small Cell Lung Cancer   Epithelial Ovarian Cancer   SARS-CoV-2 Infection   HPV Infection  
/
HY-P1724 Neomyosuppressin
Neomyosuppressin (Dromyosuppressin) is a myosuppressive peptide. Neomyosuppressin is isolable from head extracts of Neobellieria bullata, as well as the brains and intestines of Drosophila melanogaster. Neomyosuppressin inhibits spontaneous visceral muscle movements of isolated insect hindguts and oviducts, as well as contractions of various insect visceral muscles. Neomyosuppressin slows the heart rate of adult and pupal Drosophila without altering rhythmicity.
Others  
Heart Disease   Muscle Disease  
/
HY-P991491 VIR-7229
VIR-7229 is a human IgG1 monoclonal antibody (mAb) targeting Receptor-Binding Domain, RBD, Spike glycoprotein. VIR-7229 exerts antiviral activity by competing with ACE2 for binding and inducing S1 protein shedding. VIR-7229 can be used in SARS-CoV-2 infection research. Recommended isotype control: Human IgG1 kappa, Isotype Control (HY-P99001).

Species: Human

SARS-CoV   Influenza Virus  
SARS-CoV-2 Infection  
/
HY-N0684B (Rac)-Vitamin K1
(Rac)-Vitamin K1 ((Rac)-Phylloquinone; (Rac)-Phytomenadione) is a vitamin (phylloquinone) found in Urtica dioica that targets angiotensin-converting enzyme 2 (ACE-2). (Rac)-Vitamin K1 can be used in studies related to coronavirus disease 2019 (COVID-19).
Angiotensin-converting Enzyme (ACE)  
Coronavirus Infection  
/
HY-N0468R Rebaudioside D (Standard)
Rebaudioside D (Standard) is the analytical standard of Rebaudioside D. This product is intended for research and analytical applications. Rebaudioside D is an orally active sweetener that targets and activates FXR, modulates Acetyl-CoA Carboxylase, and inhibits 3-hydroxy-3-methylglutaryl-CoA reductase. Rebaudioside D regulates bile acid homeostasis and lipid metabolism, reduces the synthesis rates of fatty acids and cholesterol, and exerts multiple effects including anti-adipogenesis, hepatoprotection, anti-steatosis, gut microbiota modulation, enhancement of secondary bile acid metabolism, anti-endotoxin activity, regulation of bile acid transport, and inhibition of bile acid efflux. Rebaudioside D also reduces body weight gain, visceral fat accumulation, hepatic triglyceride and cholesterol accumulation, hepatic lipid peroxidation, and decreases the circulating level of lipopolysaccharide-binding protein. Rebaudioside D additionally enhances the secondary bile acid metabolic pathway of intestinal bacteria, upregulates the gene expression of ileal organic solute transporter α, and downregulates the gene expression of hepatic bile salt export pump. Rebaudioside D does not affect glucose homeostasis, alter total caloric intake or fecal energy excretion, induce weight gain, exacerbate obesity, promote hepatic steatosis, impair brown adipose tissue function, nor change skeletal muscle metabolism-related proteins. Rebaudioside D can be used in diet-induced obesity and obesity-related research.
Reference Standards   Acetyl-CoA Carboxylase   FXR  
Metabolic or Endocrine Disease  
/
HY-N13904 Argyrin A
Argyrin A, a cyclical peptide, is a potent antitumoral agent. Argyrin A exerts its effects through a potent inhibition of the proteasome. Argyrin A leads to increased endogenous p27kip1 levels by preventing protein turnover.
Proteasome  
Cancer  
/
HY-P3142 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Angiotensin-converting Enzyme (ACE)  
Blood or Cardio-cerebrovascular Disease  
/
HY-P11610 KBP-089
KBP-089 is a dual Amylin and Calcitonin Receptor agonist. KBP-089 reduces body weight, decreases adipose tissue mass and improves glucose tolerance in obese rats. KBP-089 also eliminates lipid accumulation in the liver and muscle, and ameliorates glycemic homeostasis and insulin sensitivity. KBP-089 is applicable to the research of diseases such as obesity and type 2 diabetes.
Amylin Receptor   CGRP Receptor  
Type 2 Diabetes   Obesity  
/
HY-N2707 6-Deoxyjacareubin
6-Deoxyjacareubin is a natural xanthone, that can be isolated from the leaves of Vismia latifolia. 6-Deoxyjacareubin protects against non-apoptotic cell death by inhibiting ROS production. 6-Deoxyjacareubin ameliorates neurodegeneration in a mouse model of familial amyotrophic lateral sclerosis (ALS).
Reactive Oxygen Species (ROS)  
Cancer   Neurological, Eye or Ear Disease  
/
HY-P2302 Defensin HNP-3 human
Defensin HNP-3 human is an α-defensin stored in the azurophilic granules of human neutrophils. Defensin HNP-3 human exerts broad-spectrum bactericidal, antifungal and antiviral activities mainly by forming bacterial membrane pores, and acts as a chemoattractant for monocytes and T cells. Defensin HNP-3 human maintains epithelial integrity to support periodontal tissue homeostasis, and exerts concentration-dependent effects on epithelial cell proliferation, adhesion and bacterial adhesion. Defensin HNP-3 human targets solid tumors and leukemia by inducing single-strand DNA breaks and membrane permeabilization in tumor cells via electrostatic binding and pore formation. Defensin HNP-3 human is abundant in human tongue squamous cell carcinoma and neutrophils infiltrating oral squamous cell carcinoma. Defensin HNP-3 human can be applied to research related to periodontitis and human tongue squamous cell carcinoma.
Antibiotic   Bacterial   Fungal  
Infection   Digestive System Disease   Squamous Cell Carcinoma   Periodontal Disease  
/
HY-B0260S Methylprednisolone-d3
Methylprednisolone-d3 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels.
Isotope-Labeled Compounds   Glucocorticoid Receptor   Autophagy   SARS-CoV  
Cancer   Infection   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P3141 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
Angiotensin-converting Enzyme (ACE)  
Infection  
/
HY-B0260S3 Methylprednisolone-d7
Methylprednisolone-d7 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels.
Glucocorticoid Receptor   Autophagy   SARS-CoV  
Cancer   Infection   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-113089AR Epsilon-(gamma-glutamyl)-lysine TFA (Standard)
Epsilon-(gamma-glutamyl)-lysine TFA (Standard) (H-Glu(H-Lys-OH)-OH TFA (Standard)) is the analytical standard of Epsilon-(gamma-glutamyl)-lysine TFA (HY-113089A). This product is intended for research and analytical applications. Epsilon-(gamma-glutamyl)-lysine TFA (H-Glu (H-Lys-OH)-OH) is an isodipeptide formed during the proteolytic degradation of proteins containing Nε-(γ-glutamyl)-lysine cross-links. Epsilon-(gamma-glutamyl)-lysine TFA serves as a substrate for γ-glutamylamine cyclotransferase, which specifically cleaves it. Epsilon-(gamma-glutamyl)-lysine TFA is applicable to studies related to transglutaminase-mediated protein cross-linking and turnover, γ-glutamylamine cyclotransferase activity, glaucoma, and tissue scar formation.
Reference Standards   Endogenous Metabolite  
Glaucoma  
/
HY-W008385R H-HoArg-OH (Standard)
H-HoArg-OH (Standard) (L-Homoarginine (Standard)) is the analytical standard of H-HoArg-OH (HY-W008385). This product is intended for research and analytical applications. H-HomoArg-OH (L-Homoarginine) is an orally active endogenous non-protein amino acid. H-HomoArg-OH acts as a weak alternative substrate for NOS and interferes with NO production, selectively inhibits tissue-nonspecific alkaline phosphatase (TNAP), and suppresses the uptake of arginine by y+-type transporters (system y+). H-HomoArg-OH increases tissue hArg concentrations in vivo, regulates amino acid homeostasis, and improves renal function and pathological features of diabetic nephropathy. H-HomoArg-OH can be used in studies related to diabetes and cardiomyopathy.
Reference Standards   Endogenous Metabolite   Monocarboxylate Transporter   Phosphatase  
Glucose Metabolism   Cardiomyopathy  
/
HY-B0260S6 Methylprednisolone-d3-1
Methylprednisolone-d3-1 (U 7532-d3-1) is the deuterium labeled Methylprednisolone (HY-B0260). Methylprednisolone (U 7532) is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels.
Isotope-Labeled Compounds   SARS-CoV   Autophagy   Glucocorticoid Receptor   Bacterial  
Cancer   Infection   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
/
HY-B0260S4 Methylprednisolone-d2
Methylprednisolone-d2 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels.
Glucocorticoid Receptor   Autophagy   SARS-CoV  
/
HY-P11023 E16-uPA24
E16-uPA24 is a chimeric peptide targeting urokinase-type plasminogen activator receptor (uPAR). E16-uPA24 modifies senescent cells surface with polyglutamic acid, promoting immune cell-mediated responses through glutamate recognition. E16-uPA24 induces immune clearance of senescent cells and restores tissue homeostasis by enhancing immune cells recruitment and directly coupling senescent cells and immune cells. E16-uPA24 can be used for tissue degeneration, chronic inflammatory disease and age-related tumorigenesis research.
Others  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-113089A Epsilon-(gamma-glutamyl)-lysine TFA
Epsilon-(gamma-glutamyl)-lysine TFA (H-Glu (H-Lys-OH)-OH) is an isodipeptide formed during the proteolytic degradation of proteins containing Nε-(γ-glutamyl)-lysine cross-links. Epsilon-(gamma-glutamyl)-lysine TFA serves as a substrate for γ-glutamylamine cyclotransferase, which specifically cleaves it. Epsilon-(gamma-glutamyl)-lysine TFA is applicable to studies related to transglutaminase-mediated protein cross-linking and turnover, γ-glutamylamine cyclotransferase activity, glaucoma, and tissue scar formation.
Endogenous Metabolite  
Glaucoma  
/
HY-126419 Kobophenol A
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC50 of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC50 of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC50 of 52 µM.
SARS-CoV   PKC  
/
HY-D1270 Direct Violet 1
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and ACE2 inhibitor with IC50s of 1.47-2.63 μM.
SARS-CoV  
SARS-CoV-2 Infection  
/
HY-P991342 CQY684
CQY684 (PCA062 antibody) is a monoclonal antibody targeting CDH3/P-cadherin, which locks P-cadherin in an X-dimer conformation and enhances the stability of this adhesion structure. CQY684 induces P-cadherin phosphorylation and promotes its dissociation from the cytoplasmic region of P-cadherin. As an endocytosis inducer and lysosome-targeting agent, CQY684 facilitates the internalization of the P-cadherin-CQY684 complex and improves the turnover efficiency of P-cadherin. CQY684 serves as a platform for the delivery of intracellular anticancer compounds, which is achieved through the targeted lysosomal transport of the antibody-P-cadherin complex. CQY684 is applicable to the research of breast cancer, esophageal cancer, and head and neck cancer.

Species: Human

Cadherin  
Breast Cancer   Esophageal Cancer  
/
HY-P99346 Regdanvimab
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with ACE2 for viral entry. Regdanvimab can be used for the research of COVID-19.

Species: Virus

SARS-CoV   Angiotensin-converting Enzyme (ACE)  
Coronavirus Infection  
/
HY-P6825 Ancelvotide Guraxetan
PNT2001 (LY4181530) is a high-affinity PSMA-targeted radiopharmaceutical ligand precursor. natLu-PNT2001 has an IC50 of 3.1 nM against PSMA. PNT2001 is applicable for PSMA targeting, radiopharmaceutical ligand delivery, and prostate cancer-related research.
PSMA  
Prostate Cancer  
/
HY-P2616A Mca-YVADAP-Lys(Dnp)-OH TFA
Cholinesterase (ChE)   Caspase  
/
HY-145512 N-(α-Linolenoyl) tyrosine
N-(α-Linolenoyl) tyrosine (NLT) is a dopaminergic agonist capable of crossing the blood-brain barrier. N-(α-Linolenoyl) tyrosine increases the level, turnover rate and release amount of dopamine in the striatum. N-(α-Linolenoyl) tyrosine modulates rotational behavior in a rat model with unilateral striatal injury and alleviates excessive blinking symptoms in models induced by dopamine-depleting agents. N-(α-Linolenoyl) tyrosine can be used for research on Parkinson's disease and idiopathic blepharospasm.
Dopamine Receptor  
Parkinson's Disease   Muscle Relaxation and Spasm  
/
HY-113089 Epsilon-(gamma-glutamyl)-lysine
Epsilon-(gamma-glutamyl)-lysine (H-Glu (H-Lys-OH)-OH) is an isodipeptide formed during the proteolytic degradation of proteins containing Nε-(γ-glutamyl)-lysine cross-links. Epsilon-(gamma-glutamyl)-lysine serves as a substrate for γ-glutamylamine cyclotransferase, which specifically cleaves it. Epsilon-(gamma-glutamyl)-lysine is applicable to studies related to transglutaminase-mediated protein cross-linking and turnover, γ-glutamylamine cyclotransferase activity, glaucoma, and tissue scar formation.
Endogenous Metabolite  
Glaucoma  
/
HY-W012340 H-HomoArg-OH hydrochloride
H-HomoArg-OH hydrochloride (L-Homoarginine hydrochloride) is an orally active endogenous non-protein amino acid. H-HomoArg-OH hydrochloride acts as a weak alternative substrate for NOS and interferes with NO production, selectively inhibits tissue-nonspecific alkaline phosphatase (TNAP), and suppresses the uptake of arginine by y+-type transporters (system y+). H-HomoArg-OH hydrochloride increases tissue hArg concentrations in vivo, regulates amino acid homeostasis, and improves renal function and pathological features of diabetic nephropathy. H-HomoArg-OH hydrochloride can be used in studies related to diabetes and cardiomyopathy.
Endogenous Metabolite   Monocarboxylate Transporter   Phosphatase  
Glucose Metabolism   Cardiomyopathy  
/
HY-W013755S Dioctyl phthalate-d4
Dioctyl phthalate-d4 (DNOP-d4) is the d4-labeled Dioctyl phthalate (HY-W013755). Dioctyl phthalate (DNOP) is a plasticizer. Dioctyl phthalate increases the activities of alanine aminotransferase (ALT) and alkaline phosphatase (ALP) in the liver, as well as the levels of creatinine and urea in the kidney. Exposure to Dioctyl phthalate disrupts the homeostasis of the intestinal microbial community, increases the abundance of pathogenic bacteria, and reduces the abundance of beneficial bacteria such as Lactobacillus. Dioctyl phthalate induces significant and dose-dependent inflammatory responses in the liver, spleen and kidney of mice.
Isotope-Labeled Compounds   Biochemical Assay Reagents   Aminotransferases (Transaminases)   Phosphatase   Bacterial  
Inflammation or Immune System Disease  
/
HY-P990180 Anti-Mouse NKG2A/C/E Antibody (20D5)
Anti-Mouse NKG2A/C/E Antibody (20D5) is an anti-mouse NKG2A/C/E IgG2a monoclonal antibody. Anti-Mouse NKG2A/C/E Antibody (20D5) can activate natural killer (NK) and CD8+ T cells. Anti-Mouse NKG2A/C/E Antibody (20D5) can exacerbate liver pathological damage by enhancing the activation of iNKT cells. Anti-Mouse NKG2A/C/E Antibody (20D5) can be used for researches on cancer and immunology such as lymphoma.

Species: Mouse

C-type Lectin-like Receptors (CTLRs)  
Cancer   Inflammation or Immune System Disease  
/
HY-B0590S Tetrabenazine-d6
Tetrabenazine-d6 (Deutetrabenazine) is a deuterium-labled Tetrabenazine (HY-B0590). Tetrabenazine (Ro 1-9569) is a brain-penetrant and orally active VMAT2-selective ligand with human VMAT2 Ki 100 nM. Tetrabenazine binds VMAT2 to block monoamine uptake into synaptic vesicles, potentiates cytoplasmic monoamine degradation. Tetrabenazine weakly blocks dopamine D2 receptors, and increases dopamine turnover via elevated cerebrospinal fluid homovanillic acid. Tetrabenazine can be used for the research of Huntington’s disease, tardive dyskinesia, and Tourette’s syndrome.
Monoamine Transporter  
Huntington's Disease  
/
HY-111355S Cholesterol sulfate-d7 sodium
Cholesterol sulfate sodium-d7 is the deuterium labeled Cholesterol sulfate sodium. Cholesterol sulfate sodium is a naturally occurring, orally active cholesterol derivative that is widely distributed in various tissues and body fluids. Cholesterol sulfate sodium acts as a DOCK2 inhibitor, with IC50 values of 2 μM and 2.9 μM against mouse and human targets, respectively. Cholesterol sulfate sodium restricts excessive neutrophil infiltration and alleviates intestinal inflammation and damage. Cholesterol sulfate sodium serves as an activator of protein kinase C (PKC), which promotes squamous cell differentiation and inhibits skin carcinogenesis. Cholesterol sulfate sodium regulates cholesterol homeostasis and cellular metabolism by activating the AMPK-Sirt1 pathway. Cholesterol sulfate sodium can be used in research related to actinic keratitis, ulcerative colitis, skin cancer, and other conditions.
Isotope-Labeled Compounds   PKC   Endogenous Metabolite   DOCK   Sirtuin   AMPK  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-126848 Diclofenac acyl glucuronide
Diclofenac acyl glucuronide (D-1-O-G) is an orally active glucuronide metabolite of Diclofenac (HY-15036). Diclofenac acyl glucuronide exhibits SOD inhibitory activity, COX-1 inhibitory activity (IC50 = 0.620 μM), and COX-2 inhibitory activity (IC50 = 2.91 μM). Diclofenac acyl glucuronide induces reactive oxygen species (ROS) production and acts as a substrate of OATP2B1. Diclofenac acyl glucuronide induces small intestinal ulcers. Diclofenac acyl glucuronide can be used in research related to intestinal diseases and small intestinal ulcers.
Drug Metabolite   SOD   COX   Reactive Oxygen Species (ROS)   OAT  
Peptic Ulcer Disease  
/
HY-N15135 Arabinoxylan (Medium viscosity)
Arabinoxylan Medium viscosity is an orally active Dectin-1 splice variant modulator, glucose absorption inhibitor, and chyme viscosity enhancer. Arabinoxylan Medium viscosity inhibits particulate β-glucan-induced Dectin-1A activation and mildly suppresses Dectin-1B activation. In human dendritic cells stimulated with particulate β-glucan, Arabinoxylan Medium viscosity reduces the production of IL-10 and TNF-α, and increases the production of IL-4 and IL-23. Arabinoxylan Medium viscosity also supports antifungal immune responses without activating TLR2, TLR4 or TLR5, and does not induce cytokine production when used to stimulate human dendritic cells alone. Arabinoxylan Medium viscosity increases small intestinal chyme viscosity, gets degraded in the large intestine to produce short-chain fatty acids, reduces glucose absorption and insulin response, and improves glucose homeostasis. Arabinoxylan Medium viscosity supports microbial fermentation and the growth of beneficial microbiota in the gastrointestinal tract, prevents bile acid reabsorption, and delays starch digestion. Arabinoxylan Medium viscosity can be used in research related to type 2 diabetes, impaired glucose tolerance, and metabolic syndrome.
Interleukin Related   Toll-like Receptor (TLR)   Fungal   C-type Lectin-like Receptors (CTLRs)  
Glucose Metabolism  
/
HY-W008385 H-HoArg-OH
H-HomoArg-OH (L-Homoarginine) is an orally active endogenous non-protein amino acid. H-HomoArg-OH acts as a weak alternative substrate for NOS and interferes with NO production, selectively inhibits tissue-nonspecific alkaline phosphatase (TNAP), and suppresses the uptake of arginine by y+-type transporters (system y+). H-HomoArg-OH increases tissue hArg concentrations in vivo, regulates amino acid homeostasis, and improves renal function and pathological features of diabetic nephropathy. H-HomoArg-OH can be used in studies related to diabetes and cardiomyopathy.
Endogenous Metabolite   Monocarboxylate Transporter   Phosphatase  
Glucose Metabolism   Cardiomyopathy  
/
HY-111355 Cholesterol sulfate
Cholesterol sulfate is a naturally occurring, orally active cholesterol derivative that is widely distributed in various tissues and body fluids. Cholesterol sulfate acts as a DOCK2 inhibitor, with IC50 values of 2 μM and 2.9 μM against mouse and human targets, respectively. Cholesterol sulfate restricts excessive neutrophil infiltration and alleviates intestinal inflammation and damage. Cholesterol sulfate serves as an activator of protein kinase C (PKC), which promotes squamous cell differentiation and inhibits skin carcinogenesis. Cholesterol sulfate regulates cholesterol homeostasis and cellular metabolism by activating the AMPK-Sirt1 pathway. Cholesterol sulfate can be used in research related to actinic keratitis, ulcerative colitis, skin cancer, and other conditions.
Endogenous Metabolite   DOCK   PKC   AMPK   Sirtuin  
Inflammation or Immune System Disease   Metabolic or Endocrine Disease   Melanoma  
/
HY-137940 β-Gentiobiose
β-Gentiobiose (Gentiobiose) is a natural oligosaccharide. β-Gentiobiose can promote ripening of tomato fruit.
Others  
/
HY-P99344 Bamlanivimab
Bamlanivimab (Anti-Human SARS-CoV-2; LY-CoV555) is an antiviral agent targeting the SARS-CoV-2 spike protein receptor-binding domain (RBD) with a mean Kd of 5.3 nM. Bamlanivimab binds epitopes overlapping the ACE2 binding site on both active and resting RBD conformations, blocks ACE2 attachment, mediates antibody-dependent cell-mediated cytotoxicity, and reduces viral replication and respiratory tract viral load. Bamlanivimab can be used for the research of COVID-19.

Species: Virus

SARS-CoV  
SARS-CoV-2 Infection  
/
HY-113286 4-Guanidinobutanoic acid
4-Guanidinobutanoic acid is a metabolite of arginine and an orally active SLC36A1/Hedgehog signaling pathway activator. 4-Guanidinobutanoic acid drives epithelial reprogramming, enhances intestinal stem cell function and goblet cell differentiation. 4-Guanidinobutanoic acid promotes the enrichment of Akkermansia muciniphila via mucus-dependent niche expansion, regulates intestinal homeostasis, and establishes a microbiota-host feedback loop. 4-Guanidinobutanoic acid exhibits anti-aging and healthspan-regulating properties. 4-Guanidinobutanoic acid can be used in research related to ulcerative colitis, amyotrophic lateral sclerosis, and Duchenne muscular dystrophy.
Endogenous Metabolite   Hedgehog  
Amyotrophic Lateral Sclerosis   Ulcerative Colitis   Duchenne Muscular Dystrophy  
/
HY-111355B Cholesteryl sulfate sodium
Cholesterol sulfate sodium is a naturally occurring, orally active cholesterol derivative that is widely distributed in various tissues and body fluids. Cholesterol sulfate sodium acts as a DOCK2 inhibitor, with IC50 values of 2 μM and 2.9 μM against mouse and human targets, respectively. Cholesterol sulfate sodium restricts excessive neutrophil infiltration and alleviates intestinal inflammation and damage. Cholesterol sulfate sodium serves as an activator of protein kinase C (PKC), which promotes squamous cell differentiation and inhibits skin carcinogenesis. Cholesterol sulfate sodium regulates cholesterol homeostasis and cellular metabolism by activating the AMPK-Sirt1 pathway. Cholesterol sulfate sodium can be used in research related to actinic keratitis, ulcerative colitis, skin cancer, and other conditions.
Sirtuin   AMPK   PKC   Endogenous Metabolite   DOCK  
Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-B1770 Sodium Iodide,99%
Sodium Iodide is a compound composed of sodium ions and iodine ions. Sodium Iodide scavenges hydrogen peroxide. Sodium Iodide maintains the level of thyroid hormone T3 through its iodine component. Sodium Iodide protects tissues from oxidative damage and regulates thyroid homeostasis. Sodium Iodide relieves acute myocardial infarction.
Environmental Pollutants   Biochemical Assay Reagents  
Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
/
HY-P73489 ACE2 Protein, Human (HEK293, His)
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

Species: Human; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P78055 ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi)
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Species: Human; Source: HEK293

Enzymes & Regulators Biotinylated Proteins Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P72809 ACE2 Protein, Rat (HEK293, His)
ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

Species: Rat; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P74433 ACE2 Protein, Mouse (HEK293, His-Fc)
ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293 , with C-hFc, C-His, C-8*His labeled tag.

Species: Mouse; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P77148 PLBD2 Protein, Human (HEK293, His)
The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag.

Species: Human; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3)

/
HY-P72808 ACE2 Protein, Human (sf9, His)
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Species: Human; Source: Sf9 insect cells

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P72029 ACE2 Protein, Cynomolgus (HEK293, hFc)
ACE2 Protein, Cynomolgus (HEK293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 is also an essential regulator of cardiac function and blood pressure control.

Species: Cynomolgus; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P72810 ACE2 Protein, Rhesus Macaque (HEK293, Fc)
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

Species: Rhesus Macaque; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P78718 ACE2 Protein, Paguma larvata (HEK293, His)
ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, His) is the recombinant ACE2 protein, expressed by HEK293 , with N-His labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, His) is 723 a.a., with molecular weight of 90-115 kDa.

Species: Others; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P71411 UBE2V2 Protein, Human (His)
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (His) is the recombinant human-derived UBE2V2 protein, expressed by E. coli , with N-6*His labeled tag.

Species: Human; Source: E. coli

Ubiquitin Related Proteins Ubiquitin Enzymes E2 Enzymes Ubiquitin Conjugating Enzyme E2 V2

/
HY-P71553 PLBD2 Protein, Mouse (His)
PLBD2 Protein, a putative phospholipase, interacts with insulin-like growth factor 2 receptor (IGF2R), suggesting involvement in growth and signaling pathways. Despite unknown details about its phospholipase activity, PLBD2's exploration may unveil insights into its role in cellular homeostasis and regulatory mechanisms. PLBD2 Protein, Mouse (His) is the recombinant mouse-derived PLBD2 protein, expressed by E. coli , with N-His labeled tag.

Species: Mouse; Source: E. coli

Enzymes & Regulators Hydrolases (EC 3)

/
HY-P71557 PLBD2 Protein, Rat (His-SUMO)
The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Species: Rat; Source: E. coli

Enzymes & Regulators Hydrolases (EC 3)

/
HY-P75465 C1orf33/MRTO4 Protein, Human (His)
C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.

Species: Human; Source: E. coli

/
HY-P78054 ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Species: Cynomolgus; Source: HEK293

Enzymes & Regulators Biotinylated Proteins Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P78233 ACE2 Protein, Cynomolgus (HEK293, His-Avi)
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

Species: Cynomolgus; Source: HEK293

Enzymes & Regulators Hydrolases (EC 3) Angiotensin-converting Enzymes Angiotensin-Converting Enzyme 2 (ACE2)

/
HY-P704082 UBE2V2 Protein, Human (sf9, His, strep)
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9, His, strep) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with N-His and N-Strep labeled tag.

Species: Human; Source: Sf9 insect cells

Ubiquitin Related Proteins Ubiquitin Enzymes E2 Enzymes Ubiquitin Conjugating Enzyme E2 V2

/
HY-P704083 UBE2V2 Protein, Human
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human is the recombinant human-derived UBE2V2 protein, expressed by E. coli, with tag free.

Species: Human; Source: E. coli

Ubiquitin Related Proteins Ubiquitin Enzymes E2 Enzymes Ubiquitin Conjugating Enzyme E2 V2

/
HY-P704084 UBE2V2 Protein, Human (sf9)
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with tag free.

Species: Human; Source: Sf9 insect cells

Ubiquitin Related Proteins Ubiquitin Enzymes E2 Enzymes Ubiquitin Conjugating Enzyme E2 V2

/
HY-P80003 ACE2 Antibody (YA647)
ACE2 Antibody (YA647) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to ACE2.

Host: Rabbit; Reactivity: Human, Mouse, Rat, Hamster

Monoclonal Antibodies Recombinant Antibodies Primary Antibodies

/
HY-P85784 ACE2 Antibody (YA5476)
ACE2 Antibody (YA5476) is a Mouse-derived and non-conjugated monoclonal antibody, targeting to ACE2.

Host: Mouse; Reactivity: Human, Mouse, Rat

Monoclonal Antibodies Primary Antibodies

/
HY-P86468 ACE2 Antibody (YA6160)
ACE2 Antibody (YA6160) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to ACE2.

Host: Rabbit; Reactivity: Human

Monoclonal Antibodies Recombinant Antibodies Primary Antibodies

/

Keywords

erebosis | enterocyte turnover | intestinal homeostasis | Drosophila intestine | Ance | epithelial renewal | non-apoptotic cell death | cell-death detection | ACE2 | tissue homeostasis