2. Search Result
Search Result
Results for "

MET juxtamembrane exon 14 deletion mutants

" in MedChemExpress (MCE) Product Catalog:

2855

Inhibitors & Agonists

7

Screening Libraries

22

Fluorescent Dyes

21

Biochemical Assay Reagents

1473

Peptides

2

MCE Kits

35

Inhibitory Antibodies

98

Natural
Products

58

Recombinant Proteins

80

Isotope-Labeled Compounds

16

Antibodies

29

Click Chemistry

14

Oligonucleotides

3

GMP Molecules

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P0224
    N-Formyl-Met-Leu-Phe
    15+ Cited Publications

    fMLP; N-Formyl-MLF

    		 TNF Receptor Inflammation/Immunology
    N-Formyl-Met-Leu-Phe (fMLP; N-Formyl-MLF) is a chemotactic peptide and a specific ligand of N-formyl peptide receptor (FPR). N-Formyl-Met-Leu-Ph is reported to inhibit TNF-alpha secretion.
    N-Formyl-Met-Leu-Phe
  • HY-P0073
    Tyr-Gly-Gly-Phe-Met-OH
    4 Publications Verification

    MET-Enkephalin; METhionine enkephalin; METenkefalin

    		 Opioid Receptor Neurological Disease Cancer
    Tyr-Gly-Gly-Phe-Met-OH regulates human immune function and inhibits tumor growth via binding to the opioid receptor.
    Tyr-Gly-Gly-Phe-Met-OH
  • HY-12019
    SGX-523
    5+ Cited Publications

    		 c-Met/HGFR Cancer
    SGX523 is a exquisitely selective and ATP-competitive MET inhibitor. SGX523 potently inhibits MET with an IC50 of 4 nM and is >1,000-fold selective versus other protein kinases. Antitumor activity .
    SGX-523
  • HY-150013
    H-Met-Met-OH

    L-METhionyl-L-METhionine

    		 Amino Acid Derivatives Others
    H-Met-Met-OH (L-Methionyl-L-methionine) is a dipeptide composed of two methionine residues. H-Met-Met-OH is a dietary supplement that has been shown to have various health benefits in animals. H-Met-Met-OH is orally active .
    H-Met-Met-OH
  • HY-15735
    c-Met inhibitor 1
    1 Publications Verification

    		 c-Met/HGFR Cancer
    c-Met inhibitor 1 is an orally active c-Met inhibitor. c-Met inhibitor 1 can inhibit c-Met phosphorylation with an IC50 of 0.010 μM. c-Met inhibitor 1 has antitumor activity and can be used for the research of tumors such as gastric cancer, pancreatic cancer and malignant glioma .
    c-Met inhibitor 1
  • HY-18309
    MET kinase-IN-4

    		c-Met/HGFR VEGFR Cancer
    MET kinase-IN-4 is an orally active Met kinase inhibitor. MET kinase-IN-4 has potent Met kinase inhibitory activity with an IC50 value of 1.9 nM. MET kinase-IN-4 can be used for the research of cancer .
    MET kinase-IN-4
  • HY-13984
    NT-1
    1 Publications Verification

    EGFR mutant-IN-3

    		 EGFR ERK Apoptosis Drug Derivative Cancer
    NT-1 (EGFR mutant-IN-3) is a potent mutant EGFR inhibitor and an analog of Osimertinib (HY-15772). This mutant EGFR inhibitor suppresses FGFR WT with an IC50 of 0.4 nM. NT-1 also inhibits EGFR L858R, EGFR Exon 19 deletion and EGFR T790M. NT-1 exerts deeper inhibition on p-EGFR and p-ERK, and induces tumor cell apoptosis. NT-1 can be used in colorectal cancer research .
    NT-1
  • HY-P6440
    Met-12

    		Apoptosis Caspase Others
    Met-12 is a small peptide inhibitor of the Fas receptor. Met-12 can inhibit Fas receptor-mediated photoreceptor cell apoptosis, reduce Caspase activation. Met-12 can be used in the research of photoreceptor .
    Met-12
  • HY-P4344
    Met-Gly-Pro-AMC

    		MetAP Others
    Met-Gly-Pro-AMC is a fluorescent peptide substrate of MetAP2 .
    Met-Gly-Pro-AMC
  • HY-P990073
    Davutamig

    REGN-5093

    		 c-Met/HGFR Cancer
    Davutamig (REGN-5093) is a human IgG4-kappa, anti-MET bispecific antibody. Davutamig binds 2 distinct epitopes of MET, blocking ligand binding and inducing MET internalization and degradation. Davutamig is applicable to the research of advanced non-small cell lung cancer with MET gene abnormalities .
    Davutamig
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-P4270
    Met-Arg-Phe-Ala
    1 Publications Verification

    		 Neprilysin Neurological Disease
    Met-Arg-Phe-Ala is a peptide. Met-Arg-Phe-Ala also is a potent competitive inhibitor for enkephalin-generating endopeptidase (EGE). Met-Arg-Phe-Ala can be used for the research of neurological disease .
    Met-Arg-Phe-Ala
  • HY-W016647
    For-Met-OH

    N-FormylMEThionine

    		 Endogenous Metabolite Bacterial Infection Metabolic Disease
    For-Met-OH (N-Formylmethionine) can be involved in the translation process of bacteria, chloroplasts, and mitochondria. For-Met-OH plays different roles in different species and organelles, such as promoting the formation of protein complexes in mitochondria and acting as a degradation signal in bacteria and yeast. The level of For-Met-OH is closely related to certain diseases, for example, For-Met-OH is a potential biomarker for metabolic disorders and poor prognosis in critically ill patients .
    For-Met-OH
  • HY-P1467A
    [Met5]-Enkephalin, amide TFA

    5-METhionine-enkephalin amide TFA

    		 Opioid Receptor Neurological Disease
    [Met5]-Enkephalin, amide TFA is an agonist for δ opioid receptors as well as putative ζ ζ opioid receptors.
    [Met5]-Enkephalin, amide TFA
  • HY-168135
    PROTAC c-Met degrader-1

    		PROTACs c-Met/HGFR Cancer
    PROTAC c-Met degrader-1 is a selective and orally active c-Met PROTAC degrader with a DC50 of 6.21 nM against c-Met. PROTAC c-Met degrader-1 induces CRBN-dependent ubiquitination and proteasomal degradation of c-Met. PROTAC c-Met degrader-1 induces G0/G1 phase arrest in c-Met-dependent cancer cells. PROTAC c-Met degrader-1 kills c-Met-dependent cancer cells. PROTAC c-Met degrader-1 inhibits tumor growth in animal models. PROTAC c-Met degrader-1 can be used for the research of gastric cancer .
    PROTAC c-Met degrader-1
  • HY-P4559
    H-Pro-Met-OH

    		Dipeptidyl Peptidase Drug Intermediate Others
    H-Pro-Met-OH is a dipeptide containing proline and methionine. H-Pro-Met-OH also serves as a substrate for prolinase and prolyl dipeptidase .
    H-Pro-Met-OH
  • HY-145779
    H-Glu(Met-OH)-OH

    H-γ-Glu-MET-OH; γ-Glu-MET

    		 Dipeptidyl Peptidase Metabolic Disease
    H-Glu(Met-OH)-OH (H-γ-Glu-Met-OH; γ-Glu-Met) is a DPP-IV inhibitor with an IC50 of 2.11 mM. H-Glu(Met-OH)-OH binds to DPP-IV’s active site to block substrate binding. H-Glu(Met-OH)-OH can be used for the research of type 2 diabetes .
    H-Glu(Met-OH)-OH
  • HY-118796
    4-Hydroxy MET

    4-HO-MET; 4-Hydroxy-N-METhyl-N-ethyltryptamine

    		 5-HT Receptor Serotonin Transporter Neurological Disease
    4-Hydroxy MET (4-HO-MET; 4-Hydroxy-N-methyl-N-ethyltryptamine) is a synthetic tryptamine psychoactive substance. 4-Hydroxy MET is a partial 5-HT2A receptor agonist, a serotonin transporter inhibitor and weak norepinephrine transporter inhibitor. 4-Hydroxy MET affects emotional, motoric, and cognitive functions via serotonergic hallucinogenic activity .
    4-Hydroxy MET
  • HY-174387
    KIN-8741

    		c-Met/HGFR Cancer
    KIN-8741 is a highly selective Type IIb c-Met inhibitor. KIN-8741 has broad activity against c-Met kinase mutations. KIN-8741 shows antitumor activity in MET gene amplified and exon 14 deleted non-small cell lung cancer models. KIN-8741 can be used in the research of c-Met driven cancers, especially advanced tumors carrying MET exon 14 jump mutations, acquired drug resistance mutations, etc .
    KIN-8741
  • HY-177893
    OZD-MET 01

    		PROTACs c-Met/HGFR Cancer
    OZD-MET 01 is a chaperone-med iatedprotein PROTAC-type MET degrader. OZD-MET 01 can inhibit proliferation of H596 and H1437 cells with IC50 values of 3.07 and 3.5 μM. OZD-MET 01 can be used for the research of cancer, such as non-small cell lung cancer . (Structure Note: Pink: MET ligand (HY-50878); Blue: chaperone ligand (HY-112078); MET ligand-Linker: (HY-176950))
    OZD-MET 01
  • HY-P1756
    N-Formyl-Met-Ala-Ser

    		Formyl Peptide Receptor (FPR) Inflammation/Immunology
    N-Formyl-Met-Ala-Ser is a peptide, binds to formyl peptide receptors on neutrophils.
    N-Formyl-Met-Ala-Ser
  • HY-P4431
    H-Met-Asp-OH

    		Amino Acid Derivatives Others
    H-Met-Asp-OH is a dipeptide containing methionine and aspartic acid, which can be used for the synthesis of polypeptides .
    H-Met-Asp-OH
  • HY-W008371S2
    Fmoc-Met-OH-d3

    		Isotope-Labeled Compounds Others
    Fmoc-Met-OH-d3 is the deuterium labeled Fmoc-Met-OH.
    Fmoc-Met-OH-d3
  • HY-W022657
    H-Met-OiPr hydrochloride

    		Amino Acid Derivatives Others
    H-Met-OiPr hydrochloride is an Methionine derivative. H-Met-OiPr hydrochloride participates in the synthesis preparation of inhibitors of farnesyl-protein transferase (FTase), and can be used in cancer research .
    H-Met-OiPr hydrochloride
  • HY-P3888
    Gly-Leu-Met-NH2

    		Neurokinin Receptor Neurological Disease
    Gly-Leu-Met-NH2 is a C-terminal tripeptide of Substance P (HY-P0201). Substance P is a neuropeptide .
    Gly-Leu-Met-NH2
  • HY-P3551
    [Ala2] Met-Enkephalinamide

    		Biochemical Assay Reagents Others
    [Ala2] Met-Enkephalinamide is an active peptide. [Ala2] Met-Enkephalinamide can be used for the research of various biochemical studies .
    [Ala2] Met-Enkephalinamide
  • HY-175321
    PROTAC c-Met degrader-6

    		PROTACs c-Met/HGFR Apoptosis Cancer
    PROTAC c-Met degrader-6 is a potent and orally active c-Met PROTACdegrader. PROTAC c-Met degrader-6 significantly induces the degradation of the c-Met protein with DC50s of 0.52 nM and 0.45 nM in EBC-1 and Hs746T. PROTAC c-Met degrader-6 almost abrogates the migratory and invasion abilities of tumor cells and significantly induces the apoptosis and blocks the cell cycle in the G0/G1 phase. PROTAC c-Met degrader-6 can be used for the study of various cancers such as non-small cell lung cancer and stomach cancer (Pink: c-Met ligand (HY-W425461); Blue: E3 ligand (HY-14658); Black: Linker (HY-20797)) .
    PROTAC c-Met degrader-6
  • HY-P3548
    [D-Ala2]-Met-Enkephalinamide

    		Opioid Receptor Neurological Disease
    [D-Ala2]-Met-Enkephalinamide, an opioid peptide, is a potent opioid agonist. [D-Ala2]-Met-Enkephalinamide decreases bile flow by a central mechanism. [D-Ala2]-Met-Enkephalinamide has analgesic properties .
    [D-Ala2]-Met-Enkephalinamide
  • HY-E70758
    MET Y1235D Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1235D is a mutant of MET. MET Y1235D Recombinant Human Active Protein Kinase is a recombinant MET Y1235D protein that can be used to study MET Y1235D-related functions .
    MET Y1235D Recombinant Human Active Protein Kinase
  • HY-E70751
    MET G1163R Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET G1163R is a mutant of MET. MET G1163R Recombinant Human Active Protein Kinase is a recombinant MET G1163R protein that can be used to study MET G1163R-related functions .
    MET G1163R Recombinant Human Active Protein Kinase
  • HY-P4356
    D-Met-Met

    		Amino Acid Derivatives Others
    D-Met-Met is an orally active methionine dipeptide and has potential applications in food supplements .
    D-Met-Met
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-P4553
    H-Met-Pro-OH

    		Amino Acid Derivatives Others
    H-Met-Pro-OH is a dipeptide containing methionine and proline. H-Met-Pro-OH is a substrate for aminopeptidase P (APP) and skin fibroblast prolidase .
    H-Met-Pro-OH
  • HY-P4553A
    H-Met-Pro-OH acetate

    		Amino Acid Derivatives Others
    H-Met-Pro-OH acetate is a dipeptide containing methionine and proline. H-Met-Pro-OH acetate serves as a substrate for aminopeptidase P (APP) and skin fibroblast prolinase .
    H-Met-Pro-OH acetate
  • HY-P1467
    [Met5]-Enkephalin, amide

    5-METhionine-enkephalin amide

    		 Opioid Receptor Neurological Disease
    [Met5]-Enkephalin, amide is an agonist for δ opioid receptors as well as putative ζ ζ opioid receptors.
    [Met5]-Enkephalin, amide
  • HY-P4196
    Met-Enkephalin-Arg-Phe

    		Opioid Receptor Neurological Disease
    Met-Enkephalin-Arg-Phe is a naturally occurring heptapeptide with analgesic activity .
    Met-Enkephalin-Arg-Phe
  • HY-P1937
    Cyclo(-Met-Pro)

    		Influenza Virus Infection
    Cyclo(-Met-Pro) is a cyclic dipeptide consisting of the amino acids methionine and proline. Cyclo(-Met-Pro) exhibits weak inhibitory activity against the influenza A virus (H3N2) (5 mM, 2.1% inhibition), while cis-cyclo(Leu-Pro) and cis-cyclo(Phe-Pro) shows significant antiviral activity .
    Cyclo(-Met-Pro)
  • HY-174384
    MET Transcription-IN-1

    		c-Met/HGFR Apoptosis G-quadruplex Cancer
    MET Transcription-IN-1 (Compound C3) is an orally active MET transcription inhibitor. MET Transcription-IN-1 can efficiently bind and stabilize the G-quadruplex in the MET promoter region, thereby inhibiting c-Met expression. MET Transcription-IN-1 can also overcome drug resistance caused by specific c-Met mutations. MET Transcription-IN-1 is capable of inhibiting tumor cell proliferation, migration, and invasion, as well as inducing cell cycle arrest and apoptosis. MET Transcription-IN-1 has antitumor activity, and can be used in the research of tumors such as non-small cell lung cancer .
    MET Transcription-IN-1
  • HY-149510
    MET/PDGFRA-IN-1

    		c-Met/HGFR Apoptosis PDGFR Cancer
    MET/PDGFRA-IN-1 (compound 8c) is a MET and PDGFRA protein inhibitor (IC50: 36 μM for MET). MET/PDGFRA-IN-1 inhibits MET phosphorylation and induces cell apoptosis. MET/PDGFRA-IN-1 inhibits proliferation of MET-positive cells (IC50s: 15.3, 19.0, 22.0, 25.6, 21.0, 31.5 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .
    MET/PDGFRA-IN-1
  • HY-P0249A
    Phe-Met-Arg-Phe amide trifluoroacetate

    		Potassium Channel Neurological Disease
    Phe-Met-Arg-Phe amide trifluoroacetate is an activator of K + current, with ED50 of 23 nM in the peptidergic caudodorsal neurons.
    Phe-Met-Arg-Phe amide trifluoroacetate
  • HY-131065
    MET kinase-IN-2

    		c-Met/HGFR Cancer
    MET kinase-IN-2 is a potent, selective, orally bioavailable MET kinase inhibitor with an IC50 of 7.4 nM. MET kinase-IN-2 has antitumor activity .
    MET kinase-IN-2
  • HY-161141
    EGFR/c-Met-IN-2

    		c-Met/HGFR Cancer
    EGFR/ C-Met-in-2 (Compound H-22) is a dual inhibitor of EGFR/c-Met. EGFR/c-Met-IN-2 inhibits cell proliferation by arresting G2/M phase. EGFR/c-Met-IN-2 has antitumor activity .
    EGFR/c-Met-IN-2
  • HY-149511
    MET/PDGFRA-IN-2

    		c-Met/HGFR Apoptosis PDGFR Cancer
    MET/PDGFRA-IN-2 (compound 8h) is a MET and PDGFRA protein inhibitor. MET/PDGFRA-IN-2 induces cell apoptosis. MET/PDGFRA-IN-2 inhibits proliferation of MET-positive cells (IC50s: 9.7, 6.1, 12.0, 11.5, 8.6, 34.4 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .
    MET/PDGFRA-IN-2
  • HY-168910
    PROTAC c-Met degrader-3

    		PROTACs c-Met/HGFR Cancer
    PROTAC c-Met degrader-3 (Compound 22b) is a c-Met PROTAC degrader. PROTAC c-Met degrader-3 promotes ubiquitination and degradation of c-Met (DC50 of 0.59 nM in EBC-1 cells). PROTAC c-Met degrader-3 can be used for the research of lung cancer (Pink: c-Met ligand (HY-14721); Blue: E3 ligase CRBN ligand (HY-W249500); linker + E3 ligase ligand (HY-168911)) .
    PROTAC c-Met degrader-3
  • HY-175320
    PROTAC c-Met degrader-5

    		PROTACs c-Met/HGFR Apoptosis STAT Cancer
    PROTAC c-Met degrader-5 (Compound D19) is an orally active c-Met PROTAC degrader with DC50s of 0.42 and 0.32 nM in EBC-1 and Hs746T cells, respectively. PROTAC c-Met degrader-5 significantly induces cell apoptosis, G1 cell cycle arrest, and inhibits cell migration and invasion. PROTAC c-Met degrader-5 has potent antiproliferative and degradation efficacy against c-Met-addicted cancer cells and Tepotinib (HY-14721)-resistant cancer cells . Pink: c-Met ligand (HY-W425461); Blue: CRBN ligase ligand (HY-14658); Black: linker
    PROTAC c-Met degrader-5
  • HY-E70754
    MET Y1230A Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1230A is a mutant of MET. MET Y1230A Recombinant Human Active Protein Kinase is a recombinant MET Y1230A protein that can be used to study MET Y1230A-related functions .
    MET Y1230A Recombinant Human Active Protein Kinase
  • HY-E70749
    MET D1228N Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET D1228N is a mutant of MET. MET D1228N Recombinant Human Active Protein Kinase is a recombinant MET D1228N protein that can be used to study MET D1228N-related functions .
    MET D1228N Recombinant Human Active Protein Kinase
  • HY-E70748
    MET D1228H Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET D1228H is a mutant of MET. MET D1228H Recombinant Human Active Protein Kinase is a recombinant MET D1228H protein that can be used to study MET D1228H-related functions .
    MET D1228H Recombinant Human Active Protein Kinase
  • HY-E70755
    MET Y1230C Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1230C is a mutant of MET. MET Y1230C Recombinant Human Active Protein Kinase is a recombinant MET Y1230C protein that can be used to study MET Y1230C-related functions .
    MET Y1230C Recombinant Human Active Protein Kinase
  • HY-E70752
    MET L1195V Recombinant Human Active Protein Kinase

    		c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET L1195V is a mutant of MET. MET L1195V Recombinant Human Active Protein Kinase is a recombinant MET L1195V protein that can be used to study MET L1195V-related functions .
    MET L1195V Recombinant Human Active Protein Kinase

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: