Topics

Pain Management and Non-Addictive Therapies

Chronic Inflammation Cellular Stress Oxidative Stress Intercellular Communication & Diseases

Pain management and non-addictive therapies encompass pharmacological, biological, regenerative, and neuromodulatory strategies designed to reduce acute or chronic pain while avoiding reliance on opioid-mediated reward and dependence pathways. Pain research has progressed from describing sensory transmission to defining molecular mechanisms of nociception, sensitization, and persistent neural plasticity. Intense thermal, mechanical, and chemical stimuli activate nociceptive pathways, whereas persistent injury can remodel peripheral and central components of these pathways and produce hypersensitivity and chronic pain. Contemporary nonopioid analgesic research therefore increasingly matches treatments to inflammatory, neuropathic, or nociplastic mechanisms rather than treating pain as a uniform process. This mechanism-based strategy has generated substantial interest in ion channels, G-protein-coupled receptors, neuroimmune signaling, targeted delivery, regenerative medicine, and cell-specific neuromodulation as routes toward effective pain relief with reduced dependence liability. Peripheral nociceptors provide major molecular entry points for non-addictive pain therapeutics[1][2].

Their terminals express voltage- and ligand-gated channels including NaV1.7, NaV1.8, NaV1.9, TRPV1, and TRPA1; inflammatory cytokines, lipids, and growth factors can alter channel gating or phosphorylation, increasing action-potential generation and pain sensitivity. Bidirectional communication with immune cells further regulates inflammatory pain because immune mediators sensitize nociceptors while neuronal neuropeptides and neurotransmitters modify vascular and immune responses. Neuropathic pain adds further targets: GPR151 is upregulated after nerve injury in nociceptive dorsal-root-ganglion neurons and promotes P2X3 activity, neuronal hyperexcitability, CSF1 expression, and spinal microglial activation. Translationally, selective NaV1.8 inhibition illustrates how this biology can support nonopioid drug discovery. Suzetrigine binds the second voltage-sensing domain of NaV1.8, stabilizes its closed state, and reduces signaling in human dorsal-root-ganglion sensory neurons. Phase 3 trials after abdominoplasty and bunionectomy found greater 48-hour pain reduction with suzetrigine than placebo, although superiority over hydrocodone/acetaminophen was not demonstrated[3][4][5].

The therapeutic landscape consequently extends beyond conventional small-molecule analgesics. Biomaterial carriers can localize and sustain analgesic delivery, while regenerative strategies aim to repair damaged tissues underlying chronic inflammatory and degenerative pain; biomaterial scavengers can also remove proinflammatory reactive oxygen species that activate nociceptive mechanisms. Research is additionally exploring gene therapy, stem-cell approaches, and cell-type-specific neuromodulation as potentially durable interventions. Major gaps remain because inflammatory, neuropathic, and nociplastic pain involve heterogeneous mechanisms, current treatment efficacy varies, and translation from mechanistic targets to reliable clinical analgesia remains difficult. Even promising targeted agents require broader evidence across pain types and treatment durations. Future development therefore depends on improved patient stratification, clinically relevant models, targeted delivery, multimodal interventions, and therapies that suppress pathological signaling while preserving protective nociception.

Together, these directions position peripheral ion channels, neuroimmune signaling, tissue regeneration, and precision neuromodulation as central research areas for safer non-addictive pain management.[2][5][6].

Articles

All
  • All
  • Scientific Reviews
  • EDM
  • Blog
Most Recent
  • Most Recent
  • Oldest

Products

All
  • All
  • Inhibitors & Agonists
  • Isotope-Labeled Compounds
  • Fluorescent Dye
  • Peptides
  • Antibodies
  • Screening Libraries
  • Inhibitory Antibodies
  • Reference Standards
  • Induced Disease Models Products
  • GMP Small Molecules
  • Biochemical Assay Reagents
  • Natural Products
Cat. No. Product Name Information Application Publication
HY-17386 Rosiglitazone
Rosiglitazone (BRL 49653) is an orally active selective PPARγ agonist (EC50: 60 nM, Kd: 40 nM), with blood-brain barrier permeability. Rosiglitazone is an TRPC5 activator (EC50: 30 μM) and TRPM3 inhibitor. Rosiglitazone can be used in the research of obesity and diabetes, senescence, ovarian cancer.
PPAR   TRP Channel   Autophagy   Ferroptosis   Apoptosis  
Digestive System Disease   Prostate Cancer   Ovarian Cancer   Viral Infection   Depression   Pain   Digestive System Inflammation   Non-Small Cell Lung Cancer   SARS-CoV-2 Infection   Type 2 Diabetes   Obesity  
197
HY-D2868 DAPI
DAPI (4',6-Diamidino-2-phenylindole) is a DAPI dye. DAPI is a fluorescent dye that binds strongly to DNA. It binds to the AT base pair of the double-stranded DNA minor groove, and one DAPI molecule can occupy three base pair positions. The fluorescence intensity of DAPI molecules bound to double-stranded DNA is increased by about 20 times, and it is commonly observed with fluorescence microscopy, and the amount of DNA can be determined based on the intensity of fluorescence. DAPI cannot penetrate intact cell membranes and is commonly used for staining damaged and fixed cells. DAPI (Compound 3) is an acid-sensing ion channel 3 (ASIC3) inhibitor. DAPI binds to ASIC3 and blocks the channel function. DAPI can be used in the study of chronic pain treatment (Ex/Em = 356/451 nm).
DNA Stain   Sodium Channel  
Chronic Pain  
178
HY-D1738 DAPI dilactate
DAPI (4',6-Diamidino-2-phenylindole) dilactate is a DAPI dye. DAPI is a fluorescent dye that binds strongly to DNA. It binds to the AT base pair of the double-stranded DNA minor groove, and one DAPI molecule can occupy three base pair positions. The fluorescence intensity of DAPI molecules bound to double-stranded DNA is increased by about 20 times, and it is commonly observed with fluorescence microscopy, and the amount of DNA can be determined based on the intensity of fluorescence. DAPI cannot penetrate intact cell membranes and is commonly used for staining damaged and fixed cells. DAPI (Compound 3) is an acid-sensing ion channel 3 (ASIC3) inhibitor. DAPI binds to ASIC3 and blocks the channel function. DAPI can be used in the study of chronic pain treatment (Ex/Em = 356/451 nm).
Fluorescent Dye  
178
HY-D0814 DAPI dihydrochloride
DAPI (4',6-Diamidino-2-phenylindole) dihydrochloride is a DAPI dye. DAPI is a fluorescent dye that binds strongly to DNA. It binds to the AT base pair of the double-stranded DNA minor groove, and one DAPI molecule can occupy three base pair positions. The fluorescence intensity of DAPI molecules bound to double-stranded DNA is increased by about 20 times, and it is commonly observed with fluorescence microscopy, and the amount of DNA can be determined based on the intensity of fluorescence. DAPI cannot penetrate intact cell membranes and is commonly used for staining damaged and fixed cells. DAPI (Compound 3) is an acid-sensing ion channel 3 (ASIC3) inhibitor. DAPI binds to ASIC3 and blocks the channel function. DAPI can be used in the study of chronic pain treatment (Ex/Em = 356/451 nm).
DNA Stain   Sodium Channel  
Neurological, Eye or Ear Disease  
178
HY-P1410 GsMTx4
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology.
TRP Channel   Piezo Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
135
HY-101840 EIPA
EIPA (L593754) is an orally active TRPP3 channel inhibitor with an IC50 of 10.5 μM. EIPA also enhances autophagy by inhibiting Na+/H+-exchanger 3 (NHE3). EIPA inhibits macropinocytosis as well. EIPA can be used in the research of inflammation and cancers, such as gastric cancer, colon carcinoma, pancreatic carcinoma.
TRP Channel   Prostaglandin Receptor   Autophagy   COX   Na+/H+ Exchanger (NHE)  
Colorectal Cancer   Prostate Cancer   Gastric Cancer   Pancreatic Cancer   Depression   Pain   Rheumatoid Arthritis  
112
HY-L011 Membrane Transporter/Ion Channel Compound Library
Most of molecules enter or leave cells mainly via membrane transport proteins, which play important roles in several cellular functions, including cell metabolism, ion homeostasis, signal transduction, the recognition process in the immune system, energy transduction, etc. There are three major types of transport proteins, ATP-powered pumps, channel proteins and transporters. Transport proteins such as channels and transporters play important roles in the maintenance of intracellular homeostasis, and mutations in these transport protein genes have been identified in the pathogenesis of a number of hereditary diseases. In the central nervous system, ion channels have been linked to, but not limited to, many diseases such asataxias, paralyses, epilepsies, and deafness. This indicates the roles of ion channels in the initiation and coordination of movement, sensory perception, and encoding and processing of information. Ion channels are a major class of drug targets in drug development. MCE designs a unique collection of 2,278 smal-molecule modulators that can be used for the research of Ion Channel and Membrane Transporter or high throughput screening (HTS) related drug discovery.

Signaling Pathway Targeting Libraries

90
HY-10448 Capsaicin
Capsaicin ((E)-Capsaicin), an active component of chili peppers, is a TRPV1 agonist. Capsaicin induces a nociceptive response by binding to its receptors. Capsaicin has analgesic effects on neurological disorders. Capsaicin has antioxidant, anti-inflammatory, anti-cancer effects.
Environmental Pollutants   Endogenous Metabolite   Autophagy   TRP Channel   Apoptosis  
Digestive System Disease   Breast Cancer   Prostate Cancer   Viral Infection   Pain   Digestive System Inflammation   SARS-CoV-2 Infection  
87
HY-L017 Stem Cell Signaling Compound Library
Adult stem cells are important for tissue homeostasis and regeneration due to their ability to self-renew and generate multiple types of differentiated daughters. Self-renewal is reflected by their capacity to undergo multiple/limitless divisions. Several signaling pathways are involved in self-renewal of stem cells, that is, Notch, Wnt, and Hedgehog pathways or Polycomb family proteins. Recent studies mainly focus on cancer stem cell (CSCs), induced pluripotent stem cell (iPSCs), neural stem cell and maintenance of embryonic stem cell pluripotency. Among them, CSCs have been believed to be responsible for tumor initiation, growth, and recurrence that have implications for cancer therapy. MCE owns a unique collection of 2,931 compounds that can be used for stem cell regulatory and signaling pathway research.

Signaling Pathway Targeting Libraries

86
HY-L077 Anti-Pancreatic Cancer Compound Library
Pancreatic cancer is a devastating disease with a low overall survival rate. Chemotherapy is the most common treatment for patients presenting with advanced pancreatic cancer. More recently, the era of targeted therapies has generated a lot of interest in discovering better approaches for patients with pancreatic cancer. Commonly mutated genes in pancreatic cancer include K-ras (in 74-100% of cases), p16INK4a (up to 98%), p53 (43 to 76%), DPC4 (about 50%), HER-2/neu (in about 65%) and FHIT (found in 70% of cases). Other genes involved are notch1, Akt-2, BRCA2 and COX-2. These proteins are important targets of target therapies for pancreatic cancer. MCE offers a unique collection of 4,336 compounds with identified and potential anti- pancreatic cancer activity. These compounds target K-Ras, p53, HER2, Notch, AKT, etc. MCE anti-pancreatic cancer compound library is a useful tool for anti-pancreatic cancer drugs screening and other related research.

Disease Focused Libraries

85
HY-L099 Targeted Diversity Library
MCE Targeted Diversity Library contains 2,294 compounds, covering more than 1000 targets and isoforms, such as GPCRs, Ion channel, variety of kinases, etc. 1-3 compounds with high potency and selectivity were carefully selected for each target and isoform. The bioactivity information of each compound has been clearly reported in the literatures. This library is a concise collection of small molecule compounds with comprehensive target coverage, which can be used for phenotypic screening at low cost.

General Bioactive Screening Libraries

85
HY-L143 Marine-Sourced Natural Product Library
Oceans cover more than 70% of the Earth’s surface and host a huge species diversity. Marine organisms are considered the most recent source of bioactive natural products after terrestrial plants and nonmarine microorganisms. Marine biological sources are taxonomically diverse and include sponges, tunicates, corals, mollusks, fungi, and sediment-derived bacteria. Marine organisms can produce a plethora of small molecules with novel chemical structures and potent biological properties, being a rich source for the discovery of pharmacologically active compounds, already with several marine-derived agents approved as drugs. Ziconotide, a peptide originally discovered in a tropical cone snail, was the first marine-derived compound to be approved in the United States in December 2004 for the treatment of pain. Then, in October 2007, Trabectedin became the first marine anticancer drug to be approved in the European Union. MCE offers a unique collection of 60 marine-sourced natural products which can be used for drug discovery for high throughput screening (HTS) and high content screening (HCS). MCE marine-sourced natural product library is an important source for drug discovery and development.

Natural Product Screening Libraries

85
HY-L046 Anti-Cardiovascular Disease Compound Library
Cardiovascular diseases (CVDs) are a group of disorders of the heart and blood vessels which include coronary heart disease, cerebrovascular disease, peripheral arterial disease, rheumatic heart disease, etc. CVDs are the number 1 cause of death globally. Smoking, unhealthy nutrition, aging population, lack of physical activity, arterial hypertension, or diabetes can promote cardiovascular disease like myocardial infarction or stroke. It is multifactorial and encompasses a multitude of mechanisms, such as eNOS uncoupling, reactive oxygen species formation, chronic inflammatory disorders and abnormal calcium homeostasis. Antioxidant, anti-inflammatory and anti-diabetes agents may reduce the cardiovascular disease risk. MCE supplies a unique collection of 2,468 compounds with confirmed anti-cardiovascular activity. These compounds mainly target metabolic enzyme, membrane transporter, ion channel, inflammation related signaling pathways. MCE Anti-Cardiovascular Disease Compound Library can be used for cardiovascular diseases related research and high throughput and high content screening for new drugs.

Disease Focused Libraries

84
HY-L071 Alkaloids Library
Alkaloids are a large and complex group of cyclic compounds that contain N. About 2,000 different alkaloids have been isolated. Important alkaloids include morphine, strychnine, atropine, colchicine, ephedrine, quinine, and nicotine. Alkaloids are useful as diet ingredients, supplements, and pharmaceuticals, in medicine and in other applications in human life. They showed anti-inflammatory, anticancer, analgesics, local anesthetic and pain relief, neuropharmacologic, antimicrobial, antifungal, and many other activities. Alkaloids are also important compounds in organic synthesis for searching new semisynthetic and synthetic compounds with possibly better biological activity than parent compounds. MCE designs a unique collection of 594 alkaloids that all come from natural products. MCE Alkaloids Library is a useful tool for drug discovery that can be used for high throughput screening (HTS) and high content screening (HCS).

Structure Classified Natural Product Libraries

84
HY-L075 Anti-Lung Cancer Compound Library
Lung cancer is a major global health problem, as it is the leading cause of cancer-related deaths worldwide. Lung cancer is divided into two categories: small cell lung cancer and non-small cell lung cancer (NSCLC). Non-small cell lung cancer accounts for about 85 percent of lung cancers. As with all cancers, lung cancer may be treated with surgery, chemotherapy, radiation therapy, targeted therapy, immunotherapy or a combination thereof. Targeted therapy is one of the most exciting developments in lung cancer medicine, especially for NSCLC. Extensive genomic characterization of NSCLC has led to the identification of molecular subtypes of NSCLC that are oncogene addicted and exquisitely sensitive to targeted therapies. These include activating mutations in epidermal growth factor receptor (EGFR) and BRAF or echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) fusions and ROS1 receptor tyrosine kinase fusions. These are important targets for target therapy. MCE offers a unique collection of 3,061 compounds with identified and potential anti-lung cancer activity. These compounds target lung cancer’s major targets and signaling pathways. MCE anti-lung cancer compound library is a useful tool for anti-lung cancer drugs screening and other related research.

Disease Focused Libraries

84
HY-L080 Targeted Therapy Drug Library
Targeted cancer therapies are drugs or other substances that block the growth and spread of cancer by interfering with specific molecular targets that are involved in the growth, progression, and spread of cancer. There are several different types of targeted therapy. The most common types are small-molecule drugs and monoclonal antibodies. Small-molecule drugs are small enough to enter cells easily, so they are used for targets that are inside cells, while monoclonal antibodies are usually used for targets that are located outside the cells. Because of high specificity, low side effect and potent anticancer activity, targeted therapy has become the mainstream of new anti-tumor drugs. Various targeted therapies have been approved by FDA and used in the treatment of diseases. MCE carefully collects a unique of 106 targeted therapy drugs used in cancer treatment. MCE Targeted therapy drug library is a useful tool for the research of targeted therapy.

Disease Focused Libraries

84
HY-L151 PROTAC Library
PROTACs (Proteolysis-targeting chimeras) is a class of molecules that utilize ubiquitin-proteasome system (UPS) to ubiquitinate and degrade target proteins. The PROTACs molecule consists of two ligands joined by a linker. The one-to-one interaction between PROTACs and target proteins determines the high efficiency of PROTACs, making it a potential molecule for targeted protein degradation (TPD) therapy. MCE supplies a unique collection of 544 PROTACs that effectively degrade target proteins with more powerful screening capability. MCE PROTAC Library is a useful tool for signal pathway research, protein degradation therapy research, drug discovery and drug repurposing, etc.

Compound Characteristic Classified Libraries

84
HY-L188 Anti-Brain Cancer Compound Library
Although brain cancer only accounts for 2% of all tumors, it has a poor prognosis, high mortality and high recurrence rate. Brain cancer can be divided into primary brain cancer and secondary brain cancer. According to the location of the cancer, brain cancer can also be divided into: brain glioma, pituitary adenoma, schwannoma, craniopharyngioma, meningioma and so on. Glioma is the most common primary brain tumor, accounting for about 1/3 of all brain tumors. At present, brain cancer lacks precision targeted therapeutic drugs, and there is still a great clinical demand that has not been met. With the continuous development of high-throughput screening technology, it may be able to help develop effective anti-brain cancer drugs by screening compounds targeting PKC, PD-1, c-Met, PARP, etc targets. MCE designs a unique collection of 2,134 small molecules with definite or potential anti-brain cancer activity, which is an important tool for studying the pathological mechanism of brain cancer and developing drugs for brain cancer.
84
HY-L038 Differentiation Inducing Compound Library
Stem cells, which are found in all multi-cellular organisms, can divide and differentiate into diverse special cell types and can self-renew to produce more stem cells. To be useful in therapy, stem cells must be converted into desired cell types as necessary which is called induced differentiation or directed differentiation. Understanding and using signaling pathways for differentiation is an important method in successful regenerative medicine. Small molecules or growth factors induce the conversion of stem cells into appropriate progenitor cells, which will later give rise to the desired cell type. There is a variety of signal molecules and molecular families that may affect the establishment of germ layers in vivo, such as fibroblast growth factors (FGFs); the wnt family or superfamily of transforming growth factors β (TGFβ) and bone morphogenetic proteins (BMP). Unfortunately, for now, a high cost of recombinant factors is likely to limit their use on a larger scale in medicine. The more promising technique focuses on the use of small molecules. These small molecules can be used for either activating or deactivating specific signaling pathways. They enhance reprogramming efficiency by creating cells that are compatible with the desired type of tissue. It is a cheaper and non-immunogenic method. MCE Differentiation Inducing Compound Library contains a unique collection of 2,574 compounds that act on signaling pathways for differentiation. These compounds are potential stimulators for induced differentiation. This library is a useful tool for researching directed differentiation and regenerative medicine.

Signaling Pathway Targeting Libraries

83
HY-L039 Reprogramming Compound Library
Techniques for reprogramming somatic cells create new opportunities for drug screening, disease modeling, artificial organ development, and cell therapy. The development of reprogramming techniques has grown exponentially since Yamanaka reprogrammed somatic cells to become induced pluripotent stem cells (iPSCs) using four transcription factors, OCT4, SOX2, KLF4, and c-MYC in 2006. Despite the development of efficient reprogramming methods, most methods are inappropriate for clinical applications because they carry the risk of integrating exogenous genetic factors or use oncogenes. Alternative approaches, such as those based on miRNA, non-viral genes, non-integrative vectors, and small molecules, have been studied as possible solutions to the problems. Among these alternatives, small molecules are attractive options for clinical applications. Reprogramming using small molecules is inexpensive and easy to control in a concentration- and time-dependent manner. It offers a high level of cell permeability, ease of synthesis and standardization, and it is appropriate for mass-producing cells. MCE Reprogramming Compound Library contains a unique collection of 3,231 compounds that act on reprogramming signaling pathways. These compounds are potential stimulators for reprogramming. This library is a useful tool for researching reprogramming and regenerative medicine.

Signaling Pathway Targeting Libraries

83
HY-L062 Neurotransmitter Receptor Compound Library
Neurotransmitter (NT) receptors, also known as neuroreceptors, are a broadly diverse group of membrane proteins that bind neurotransmitters for neuronal signaling. There are two major types of neurotransmitter receptors: ionotropic and metabotropic. Ionotropic receptors are ligand-gated ion channels, meaning that the receptor protein includes both a neurotransmitter binding site and an ion channel. The binding of a neurotransmitter molecule (the ligand) to the binding site induces a conformational change in the receptor structure, which opens, or gates, the ion channel. The term “metabotropic receptors” is typically used to refer to transmembrane G-protein-coupled receptors. Metabotropic receptors trigger second messenger-mediated effects within cells after neurotransmitter binding. In some neurological diseases, the neurotransmitter receptor itself appears to be the target of the disease process. Many neuroactive drugs act by modifying neurotransmitter receptors. A better understanding of neurotransmitter receptor changes in disease may lead to improvements in therapy. MCE designs a unique collection of 2,593 compounds targeting a variety of neurotransmitter receptors. MCE Neurotransmitter Receptor Compound Library is a useful tool for neurological diseases drug discovery.

Signaling Pathway Targeting Libraries

83
HY-L074 Anti-Breast Cancer Compound Library
Breast cancer is the most frequent cancer among women, impacting 2.1 million women each year, and also causes the greatest number of cancer-related deaths among women. Surgery is usually the first type of treatment for breast cancer, which is usually followed by chemotherapy or radiotherapy or, in some cases, hormone or targeted therapies, especially for metastatic breast cancer (MBC). Breast cancer is a heterogeneous disease, which is categorized into 3 major subtypes based on the presence or absence of molecular markers for estrogen or progesterone receptors and human epidermal growth factor 2 (ERBB2; formerly HER2): hormone receptor positive/ERBB2 negative (70% of patients), ERBB2 positive (15%-20%), and triple-negative (tumors lacking all 3 standard molecular markers; 15%). Different intrinsic subtypes exhibit different tumor behavior with different prognoses, and may require specific targeted therapies to maximize treatment effectiveness. Otherwise, some signaling pathways also play important roles in the development of breast cancer, such as NF-κB Signaling Pathway, TGF-beta Signaling Pathway, PI3K/AKT/mTOR signaling pathway and Notch Signaling Pathway. These signaling pathways offer ideal targets for development of new targeted therapies for breast cancer. MCE supplies a unique collection of 3,404 compounds with identified and potential anti-breast cancer activity. MCE Anti-Breast Cancer Compound Library is a useful tool for anti-breast cancer drugs screening.

Disease Focused Libraries

83
HY-L079 Anti-Blood Cancer Compound Library
Blood cancers, also called hematologic cancers, occur when abnormal blood cells start growing out of control, interrupting the function of normal blood cells, which fight off infection and produce new blood cells. Most blood cancers start in the bone marrow, which is where blood is produced. There are three main types of blood cancers: leukemia, lymphoma and myeloma, which afflict millions of children and adults every year, and are often deadly. Some common blood cancer treatments include stem cell transplantation, chemotherapy, radiation therapy, targeted therapy, immunotherapy or a combination thereof. As we begin to understand the key signaling pathways and molecular drivers of malignant transformation in haematological disorders, new treatment strategies will continue to be developed. MCE offers a unique collection of 4,333 compounds with identified and potential anti-blood cancer activity. These compounds target blood cancer’s major targets and signaling pathways. MCE anti-blood cancer compound library is a useful tool for anti-blood cancer drugs screening and other related research.

Disease Focused Libraries

83
HY-L105 Peptide Library
Peptides are a group of biologically active substances that are involved in various cellular functions of organisms. Peptides are often used in functional analysis, vaccine research and especially in the field of drug research and development. At present, more than 80 peptide drugs have reached the market for a wide range of diseases, including diabetes, cancer, osteoporosis, multiple sclerosis, HIV infection and chronic pain. MedChemExpress (MCE) offers a comprehensive collection of 2,647 peptides, including bioactive peptides, amino acid derivatives, and blocking peptides. MCE Peptide Library can be used for peptide library screening, peptide drug discovery, vaccine development, target verification, structural activity research, etc.

Structure Classified Libraries

83
HY-L117 Calcium Channel Blocker Library
Calcium channel blockers (CCBs), also called calcium antagonists are compounds that slow the movement of calcium (Ca2+) through calcium channels into the cells of the heart and blood vessel walls. Calcium causes the heart and arteries to squeeze more strongly. By blocking calcium, calcium channel blockers allow blood vessels to relax and open. So calcium channel blockers are usually used to lower blood pressure, relieve chest pain (angina) and control an irregular heartbeat. MCE supplies a unique collection of 226 calcium channel blockers and antagonists, all of which have the identified inhibitory effect on calcium channel. MCE Calcium Channel Blocker Library is a useful tool for discovery of antihypertensive drugs and cardiovascular disease research.

Signaling Pathway Targeting Libraries

83
HY-L118 Sodium Channel Blocker Library
Sodium channels conduct sodium ions (Na+) through a cell's plasma membrane that are the source of excitatory currents for the nervous system and muscle. Na channels are classified according to the trigger that opens the channel for such ions, i.e. either a voltage-change (Voltage-gated, voltage-sensitive, or voltage-dependent sodium channel also called VGSCs or Nav channel) or a binding of a substance (a ligand) to the channel (ligand-gated sodium channels). Dysfunction in voltage-gated sodium channels correlates with neurological and cardiac diseases, including epilepsy, myopathies, pain and cardiac arrhythmias. Sodium channel blockers are used in the treatment of cardiac arrhythmia, pain and convulsion. MCE offers a unique collection of 199 sodium channel blocker and antagonists, all of which have the identified inhibitory effect on sodium channels. MCE Sodium Channel Blocker Library can be used for neurological and cardiac diseases drug discovery and sodium channel research.

Signaling Pathway Targeting Libraries

83
HY-L119 Potassium Channel Compound Library
Potassium channels are the most widely distributed type of ion channel and are found in virtually all living organisms. There are four major classes of K channels: voltage-gated potassium channel, calcium-activated potassium channel, inwardly rectifying potassium channel and tandem pore domain potassium channel. There is growing evidence that dysfunction in potassium channels correlates with several diseases, such as chronic hypertension, diabetes, hypercholesterolemia and atherosclerosis, etc. MCE Potassium Channel Compound Library consists of 337 potassium channel inhibitor and activators, which is a useful tool to discover drugs for cardiovascular diseases and potassium channel research.

Signaling Pathway Targeting Libraries

83
HY-L139 Pain-Related Compound Library
Pain is a kind of distressing feeling caused by the stimulation of tissue damage. According to the International Association for the Study of Pain (IASP), pain is defined as ”An unpleasant sensory and emotional experience associated with actual or potential tissue damage, or described in terms of such damage”. Pain is usually classified according to its location, duration, underlying causes, and intensity. For example, acute and chronic pain, muscle pain, and nerve pain. Pain is the main symptom of most diseases, which seriously affects the quality of life and body function of patients. In the medical treatment of pain, anti-inflammatory drugs and opioid analgesic agents have traditionally been used, but the side effects are serious. In recent years, targeted drugs targeting the ERK/MAPK pathway or other targets have gradually become a research hotspot. MCE supplies a unique collection of 3,530 compounds targeting key proteins in the pain system. MCE Pain-Related Compound Library is a useful tool for pain related research and anti-pain drug development.

Disease Focused Libraries

83
HY-L150 Membrane Receptor-targeted Compound Library
Membrane receptors, also known cell surface receptors or transmembrane receptors, are transmembrane proteins embedded into the plasma membrane which play an essential role in maintaining communication between the internal processes within the cell and various types of extracellular signals. They act in cell signaling by receiving (binding to) extracellular molecules, which are also called ligands. These extracellular molecules include hormones, cytokines, growth factors, neurotransmitters, lipophilic signaling molecules such as prostaglandins, and cell recognition molecules. There are three kinds of membrane receptors: ion channel-linked receptors, enzyme-linked receptors and G-protein-linked receptors. They play important roles in keeping human normal physiologic processes. GPCRs and ion channels are important drug targets in drug discovery. MCE provides a unique collection of 7,133 compounds targeting a variety of membrane receptors. MCE Membrane reeptor-targeted Compound Library can be used for membrane receptor-focused screening and drug discovery.

Signaling Pathway Targeting Libraries

83
HY-L159 Highly Selective Activators Library
Agonistic drugs activate or stimulate their receptors, triggering responses that increase or decrease cell activity. The highly selective activators can act on specific biological or molecular targets, while non-selective activators may interfere with multiple targets or targets simultaneously. The highly selective activators reduce the likelihood of these non-specific effects by targeting specific targets, making research more precise and reliable. The Highly Selective Activators Library contains 2,192 compounds, covering multiple targets and subtypes, such as GPCR protein family, Ion channel, multiple kinases, etc. The Highly Selective Activators Library is an effective tool for screening different phenotypes.
83
HY-L166 Ion Channel Compound Library
Ion channel is a membrane-binding enzyme whose catalytic site is an ion conduction pore, which is opened and closed in response to specific environmental stimuli (voltage, ligand concentration, membrane tension, temperature, etc.). Ion channel provide pores for the passive diffusion of ions on the biofilm. Due to their high selectivity for ion, ion channel are generally classified as sodium (Na+ ), potassium (K+ ), calcium (Ca2+ ), chloride (Cl- ), and non-specific cation channel. Ion channel is an important contributor to cell signal transduction and homeostasis. In addition to electrical signal transduction, ion channel also have many functions: regulating vascular smooth muscle contraction, maintaining normal cell volume, regulating glandular secretion, protein kinase activation, etc. Therefore, dysfunction of ion channel can lead to many diseases, and its mechanism research is particularly important. MCE designs a unique collection of 1,751 small molecules related to ion channel, mainly targeting Na+ channel, K+ channel, Ca2+ channel, GABA receptor, iGluR, etc. It is an essential tool for research of cardiovascular diseases, Nervous system diseases and other diseases.

Signaling Pathway Targeting Libraries

83
HY-L171 Anti-Hematopathy Compound Library
Hematopathy, also known as hematopoietic system diseases, are a class of diseases that hematopoietic system has abnormal changes. Common hematopathy include: aplastic anemia, myeloproliferative diseases, thalassemia, leukemia, lymphoma, myeloma and hemophilia, etc. In recent years, treatments for hematopathy have been developed. In particular, the treatment of malignant hematopathy developed from chemotherapy, radiotherapy, bone marrow development to immunotherapy, induced differentiation therapy, cell therapy, gene therapy and hematopoietic stem cell transplantation. Although these therapies have greatly improved the survival rate of patients, there are still problems such as low cure rate and easy recurrence in the treatment of hematopathy. Therefore, it is of great significance to actively search for new hematopathy therapeutic drugs. MCE designs a unique collection of 4,388 anti-hematopathy small molecules, which is an effective tool for development and research of anti-hematopathy compounds.

Disease Focused Libraries

83
HY-L178 Radioprotector Library
Radiation sickness is a general term for various types and degrees of damage (or disease) occurring in the human body after exposure to ionizing radiation. Although small amounts of ionizing radiation can also cause the body to produce free radicals and ROS, causing oxidative stress, resulting in DNA damage and chromosomal aberration. Radioprotector are compounds with radiation protection that can be used to prevent/protect non-tumor cells from the harmful effects of radiation. Radioprotective compounds can prevent the damage of radioactive substances to the human body and reduce the clinical symptoms of various radioactive diseases. In addition, radioprotectors can protect normal cells from damage during radiation therapy. The ideal anti-radiation drug should not affect the sensitivity of tumor cells to radiation therapy while protecting normal cells. MCE designs a unique collection of 3,066 radioprotectors. Radioprotector Library is an effective tool for acute Radiation Syndrome, drug combination research with radiation drugs.

Compound Characteristic Classified Libraries

83
HY-L212 Neuropeptide Library
Neuropeptides are small proteins produced and released by neurons through the regulation of secretory pathways, expressed in neurons and have transmitter or co-transmitter functions, and are used as nerve substrates. Neuropeptides are by far the largest and most diverse signaling molecules in the brain and have been implicated in the development of diseases and drugs. Neuropeptides are involved in inflammatory and immune diseases and have an impact on epithelial, vascular, and connective tissue cells proliferation and tissue repair. Studies have shown that neuropeptides are particularly important when the nervous system is challenged, such as stress, injury, or substance abuse. Substance P is a neuropeptide that acts as a neurotransmitter and neuromodulator in the central nervous system and is currently in clinical research and has been shown to be involved in inflammatory processes and pain. MCE can provide 128 neuropeptides that can be used for scientific research.
83
HY-L216 Polysaccharides Compound Library
Polysaccharides are long chains of carbohydrate molecules, consisting of multiple smaller monosaccharides. Polysaccharides are found mainly in natural sources such as plants, microorganisms, algae and animals. Polysaccharides have a large number of active functional groups, different chemical compositions and different molecular weight ranges, which determines their diversity in nature and structure. Also in the field of medical research, polysaccharides act as a class of functional compounds and thus play a role. For example, nanocarrier construction, immunomodulation and vaccine development, new strategies for antitumor therapy, tissue regeneration engineering applications and disease diagnosis. With the advancement of glycomics and synthetic biotechnology, human beings are moving from “knowing polysaccharides” to “designing polysaccharides”, which will provide innovative solutions for materials science, precision medicine and sustainable development. MCE offers 70 polysaccharides that can be used in biomedical studies.
83
HY-L217 Mouse Metabolite Compound Library
Metabolic abnormalities lead to dysfunction of metabolic pathways and the accumulation or lack of metabolites, which are recognized hallmarks of the disease. The metabolite signature is closely related to the disease phenotype and is very useful for predicting the diagnosis and prognosis of the disease as well as monitoring treatment. Metabolites can be used as disease markers for diagnostic therapy. As the classic model of disease experiment in vivo, mice metabolites also play a role in disease diagnosis and mechanism research. MCE provides 330 mouse metabolites that can be used in disease research.

Metabolism Focused Libraries

83
HY-L252 Carbohydrate Metabolite Compound Library
Carbohydrate metabolism serves as a central hub for energy supply and biosynthesis in living organisms and plays a critical role in the onset and progression of various diseases. In recent years, studies have shown that tumor cells reprogram their energy metabolism through aerobic glycolysis (the Warburg effect) to support rapid proliferation. Immune cells also rely on specific carbohydrate metabolic pathways to regulate their activation and differentiation states, while disorders such as diabetes and metabolic syndrome arise directly from dysregulation of carbohydrate metabolism. In addition, enzymes and key metabolic nodes involved in carbohydrate metabolism have become important targets for drug discovery, and therapeutic strategies targeting glycolysis, the pentose phosphate pathway, and energy metabolism are continuously advancing the treatment of cancer and metabolic diseases. Therefore, systematic analysis of carbohydrate metabolic networks and their associated metabolites is of great significance for elucidating disease mechanisms and developing novel therapeutic approaches. The MCE Carbohydrate Metabolism Metabolite Library is constructed based on classical carbohydrate metabolic pathways and contains 76 metabolites. It systematically integrates key metabolic networks, including glycolysis, the pentose phosphate pathway, the tricarboxylic acid (TCA) cycle, monosaccharide metabolism, and sugar acid interconversions. The library comprehensively covers core metabolic nodes from glucose uptake and utilization to energy production and biosynthesis, while also incorporating important upstream and downstream intermediates. It enables accurate representation of intracellular metabolic flux dynamics and is well suited for applications such as metabolic flux analysis, target validation, and mechanistic studies. Furthermore, it provides robust support for multi-omics integration and the development of precision intervention strategies.
83
HY-L264 DNA Damage Repair Inhibitor Library
DNA damage response (DDR) is a fundamental mechanism for maintaining genomic stability. When DNA damage occurs, such as single- or double-strand breaks or replication fork stalling, cells rely on key proteins including ATM, ATR, PARP, and DNA-PK to sense the damage and transmit signals, thereby regulating DNA repair, cell-cycle arrest, and cell death. Inhibition of specific DNA repair or checkpoint pathways can prevent tumor cells from effectively repairing accumulated DNA damage, ultimately leading to tumor cell death. MCE DNA Damage Repair Inhibitor Library contains 1,544 compounds, focusing on key nodes involved in DNA damage response and DNA repair. The library covers multiple DNA repair and cell-cycle checkpoint pathways, providing a systematic compound screening tool for research on precision oncology, synthetic lethality, drug resistance mechanisms, and chemo- or radiosensitization.
83
HY-L923 Ion Channel Lead-like Compound Library
Ion channels are key proteins on the cell membrane that regulate the flow of ions across membranes. They participate in nearly all physiological processes, including nerve conduction, muscle contraction, heart rhythm, and pain perception. Abnormalities in their function can lead to various serious diseases such as arrhythmia, epilepsy, hypertension, neuropathic pain, and cancer. Therefore, ion channels are highly valuable drug targets—over 15% of approved drugs target ion channels currently, demonstrating their irreplaceable therapeutic value in cardiovascular, neurological, and analgesic fields. MCE has collected a library of over 5,000 reported ion channel-related bioactive compounds targeting major sites such as Na+ channels, K+ channels, Ca2+ channels, GABA receptors, iGluRs, and others. Using AI models, these compounds are characterized through both 2D representations (molecular fingerprints, pharmacophores) and 3D representations (3D conformation) to screen for a collection of lead-like compounds highly similar to known active molecules. Additionally, an hERG channel prediction algorithm integrating XGB and ISE mapping strategy is employed to assess and exclude potential cardiotoxicity in the library.. This step significantly reduces safety risks in subsequent screenings, particularly for ion channel drug development related to cardiovascular systems (e.g., Nav1.5, Cav1.2), effectively minimizing failures due to hERG inhibition and serving as a valuable tool for ion channel drug screening.

Focused and target libraries

83
HY-W009724 2-Aminoethyl diphenylborinate
2-Aminoethyl diphenylborinate (2-APB) is a cell-permeable inhibitor of Inositol triphosphate receptor (IP3R). 2-Aminoethyl diphenylborinate also inhibits the store-operated Ca2+ (SOC) channel and activates some TRP channels (V1, V2 and V3). Additionally, 2-Aminoethyl diphenylborinate has inhibitory effects on vasospasm. At high concentrations, it exhibits specific anti-inflammatory and antioxidant effects in neural tissue.
Calcium Channel   TRP Channel   CRAC Channel  
Inflammation or Immune System Disease   Pain   Hypertension   Lung Fibrosis  
82
HY-N0488A Vincristine
Vincristine (Leurocristine; NSC-67574; 22-Oxovincaleukoblastine) is a microtubule inhibitor that disrupts microtubule polymerization by binding to β-tubulin (with a Ki of 85 nM in bovine), arrests the cell cycle and induces apoptosis. Vincristine inhibits cell replication, tumor blood flow and the proliferation of various cancer cells, while triggering effects such as oxidative stress, inflammation, calcium overload, epithelial-mesenchymal transition and peripheral neuropathic pain. Vincristine upregulates the expression of various transporters and nuclear receptors, and enriches gastric cancer stem-like cells. Vincristine is used in research related to various tumors including acute lymphoblastic leukemia, lymphoma, melanoma, gastric cancer, solid tumors and sarcomas.
Apoptosis   Microtubule/Tubulin   Mitosis  
Lung Cancer   Leukemia/Lymphoma/Myeloma   Viral Infection  
79
HY-N0488 Vincristine sulfate
Vincristine (Leurocristine; NSC-67574; 22-Oxovincaleukoblastine) sulfate is a microtubule inhibitor that disrupts microtubule polymerization by binding to β-tubulin (with a Ki of 85 nM in bovine), arrests the cell cycle and induces apoptosis. Vincristine sulfate inhibits cell replication, tumor blood flow and the proliferation of various cancer cells, while triggering effects such as oxidative stress, inflammation, calcium overload, epithelial-mesenchymal transition and peripheral neuropathic pain. Vincristine sulfate upregulates the expression of various transporters and nuclear receptors, and enriches gastric cancer stem-like cells. Vincristine sulfate is used in research related to various tumors including acute lymphoblastic leukemia, lymphoma, melanoma, gastric cancer, solid tumors and sarcomas.
Apoptosis   Microtubule/Tubulin   Mitosis  
Neurological, Eye or Ear Disease   Digestive System Disease   Lung Cancer   Viral Infection   Digestive System Inflammation  
79
HY-B0285A Amiloride hydrochloride
Amiloride hydrochloride (MK-870 hydrochloride) is an inhibitor of both epithelial sodium channel (ENaC) and urokinase-type plasminogen activator receptor (uTPA). Amiloride hydrochloride is a blocker of polycystin-2 (PC2; TRPP2) channel.
Sodium Channel   TRP Channel   Apoptosis  
Metabolic or Endocrine Disease   Digestive System Disease   Pain   Digestive System Inflammation   Cardiovascular Disease   SARS-CoV-2 Infection  
72
HY-B0285 Amiloride
Amiloride (MK-870) is an inhibitor of both epithelial sodium channel (ENaC) and urokinase-type plasminogen activator receptor (uTPA). Amiloride is a blocker of polycystin-2 (PC2; TRPP2) channel.
Sodium Channel   TRP Channel   Apoptosis  
Metabolic or Endocrine Disease   Digestive System Disease   Pain   Digestive System Inflammation   Cardiovascular Disease  
72
HY-100965 Diphenyleneiodonium chloride
Diphenyleneiodonium chloride is a NADPH oxidase (NOX) inhibitor and also functions as a TRPA1 activator with an EC50 of 1 to 3 μM. Diphenyleneiodonium chloride selectively inhibits intracellular reactive oxygen species.
TRP Channel   NADPH Oxidase   Reactive Oxygen Species (ROS)  
Inflammation or Immune System Disease   Pain   Lung Fibrosis  
66
HY-15640 Capsazepine
Capsazepine is a synthetic analogue of the sensory neurone excitotoxin, and an antagonist of TRPV1 receptor with an IC50 of 562 nM.
TRP Channel   Apoptosis  
Cancer   Digestive System Disease   Pain   Digestive System Inflammation  
65
HY-B0545 Probenecid
Probenecid is a potent and selective agonist of transient receptor potential vanilloid 2 (TRPV2) channels. Probenecid also inhibits pannexin 1 channels.
TRP Channel   Bacterial   HIV  
Cancer   Metabolic or Endocrine Disease   Viral Infection   Bacterial Infection   Pain  
50
HY-15488 A 438079
A 438079 is a potent, and selective P2X7 receptor antagonist with pIC50 of 6.9.
P2X Receptor  
Neurological, Eye or Ear Disease  
27
HY-B0185 Lidocaine
Lidocaine (Lignocaine) inhibits sodium channels involving complex voltage and using dependence. Lidocaine decreases growth, migration and invasion of gastric carcinoma cells via up-regulating miR-145 expression and further inactivation of MEK/ERK and NF-κB signaling pathways. Lidocaine is an amide derivative and has potential for the research of ventricular arrhythmia.
Sodium Channel   MEK   ERK   NF-κB   Apoptosis  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Viral Infection   Depression   Pain   Digestive System Inflammation   Cardiovascular Disease   SARS-CoV-2 Infection   Obesity   Rheumatoid Arthritis  
23
HY-N1584 Halofuginone
Halofuginone (RU-19110), a Febrifugine derivative, is a competitive prolyl-tRNA synthetase inhibitor with a Ki of 18.3 nM. Halofuginone is a specific inhibitor of type-I collagen synthesis and attenuates osteoarthritis (OA) by inhibition of TGF-β activity. Halofuginone is also a potent pulmonary vasodilator by activating Kv channels and blocking voltage-gated, receptor-operated and store-operated Ca2+ channels. Halofuginone has anti-malaria, anti-inflammatory, anti-cancer, anti-fibrosis effects.
DNA/RNA Synthesis   TGF-beta/Smad   Parasite   Sodium Channel   Calcium Channel  
Inflammation or Immune System Disease   Ovarian Cancer   Parasitic Infection   Pulmonary Hypertension  
22
HY-N0140 Ursolic acid
Ursolic acid (Prunol) is a natural pentacyclic triterpenoid carboxylic acid, exerts anti-tumor effects and is an effective compound for cancer prevention and therapy.
Autophagy   Endogenous Metabolite  
Prostate Cancer   Leukemia/Lymphoma/Myeloma  
21
HY-B0246 Carbamazepine
Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC50 of 131 μM. Carbamazepine blocks voltage gated Na+, Ca2+, and K+ channels, and is also a HDAC inhibitor (IC50: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain.
Sodium Channel   Autophagy   Mitophagy   Potassium Channel   Calcium Channel   HDAC  
Breast Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Viral Infection   Digestive System Inflammation   SARS-CoV-2 Infection   Alzheimer's Disease   Hypertension  
18
HY-50697 A-740003
A-740003 is a potent, selective and competitive P2X7 receptor antagonist with IC50 values are 18 and 40 nM for rat and human P2X7 receptors, respectively.
P2X Receptor  
Neurological, Eye or Ear Disease  
17
HY-136254 BzATP triethylammonium salt
BzATP triethylammonium salt acts as a P2X receptor agonist with pEC50s of 8.74, 5.26, 7.10, 7.50, 6.19, 6.31, 5.33 for P2X1, P2X2, P2X3, P2X2/3, P2X4 and P2X7, respectively. BzATP triethylammonium salt is potent at P2X7 receptors with EC50s of 3.6 μM and 285 μM for rat P2X7 and mouse P2X7, respectively.
P2X Receptor  
Cancer   Inflammation or Immune System Disease  
17
HY-N0637 Eriodictyol
Eriodictyol ((±)-Huazhongilexone; Dihydroluteolin) is an orally active TRPV1 receptor antagonist (IC50=44-47 nM, rTRPV1) with antioxidant and anti-inflammatory activities. Eriodictyol effectively inhibits lipid peroxidation and the release of proinflammatory cytokines by specifically antagonizing the TRPV1 receptor and activating the Nrf2 signaling pathway. Eriodictyol reduces the levels of ICAM-1, VEGF, eNOS and TNF-α in the retina and maintains the integrity of the blood-retinal barrier. Eriodictyol alleviates oxidative stress-induced apoptosis and hyperalgesia, enhances the activity and cytotoxicity of immune cells (such as B lymphocytes, NK cells and macrophages), and increases the levels of antioxidant enzymes simultaneously. Eriodictyol can be used in the research of diabetic retinopathy, acute lung injury and various pain-related diseases.
Melanocortin Receptor   TRP Channel  
Cancer   Inflammation or Immune System Disease   Viral Infection   Obesity   Lung Fibrosis  
16
HY-B0211 Riluzole
Riluzole is an anticonvulsant agent and belongs to the family of use-dependent Na+ channel blocker which can also inhibit GABA uptake with an IC50 of 43 μM.
Sodium Channel   GABA Receptor  
Cancer   Alzheimer's Disease   Parkinson's Disease  
16
HY-N0021 Verbascoside
Verbascoside is isolated from Acanthus mollis, acts as an ATP-competitive inhibitor of PKC, with an IC50 of 25 μM, and has antitumor, anti-inflammatory and antineuropathic pain activity.
PKC   Apoptosis   Bacterial   HSV  
Cancer   Neurological, Eye or Ear Disease   Digestive System Disease   Viral Infection   Bacterial Infection   Digestive System Inflammation  
15
HY-13290 KN-62
KN-62 is a selective and reversible inhibitor of calmodulin-dependent protein kinase II (CaMK-II) with a Ki of 0.9 μM for rat brain CaMK-II. KN-62 directly binds to the calmodulin binding site of CaMK-II. KN-62 displays noncompetitive antagonism at P2X7 receptors in HEK293 cells, with an IC50 value of approximately 15 nM.
CaMK   P2X Receptor  
Cancer   Metabolic or Endocrine Disease  
14
HY-N2333 Resiniferatoxin
Resiniferatoxin ((+)-Resiniferatoxin), is a selective agonist of transient receptor potential vanilloid 1 (TRPV1) receptor agonist. Resiniferatoxin can be isolated from the Euphorbia resinifera plant. Resiniferatoxin eliminates TRPV1+ primary sensory afferents and blunt cardiac sympathetic afferent reflex for a relatively long period.
TRP Channel  
Cancer   Blood or Cardio-cerebrovascular Disease  
14
HY-N0131 Stigmasterol
Stigmasterol is an orally acitve, immunomodulatory agent with anti-inflammatory and neuroprotective effect, as well as able to cross the blood-brain barrier. Stigmasterol activates AMPK, which in turn inhibits NF-κB and NLRP3 signaling pathways, reduces microglia-mediated neuroinflammation, and alleviates cognitive impairment and Alzheimer's disease. Stigmasterol regulates M1/M2 polarization of microglia through the TLR4/ NF-κB pathway, thereby reducing neuropathic pain. Stigmasterol can be used for neurodegenerative diseases, inflammatory diseases, and pain management, among others.
MMP   Endogenous Metabolite  
Alzheimer's Disease   Ischemia-Reperfusion Injury  
13
HY-103259 Sodium metatungstate
Sodium metatungstate (Sodium polyoxotungstate) is a NTPDase inhibitor, with Ki values of 2.58 μM, 3.26 μM, and 28.8 μM for NTPDase 1 (CD39), NTPDase 3 and NTPDase 2 respectively. Sodium metatungstate has anti-inflammatory and anti-cancer effect. Sodium metatungstate inhibits ATP breakdown but also blocks central synaptic transmission.
Phosphatase   P2X Receptor   P2Y Receptor   Pyroptosis   Interleukin Related  
Neurological, Eye or Ear Disease   Digestive System Disease   Leukemia/Lymphoma/Myeloma   Digestive System Inflammation  
12
HY-101044 PPADS tetrasodium
PPADS tetrasodiuma is a non-selective P2X receptor antagonist. PPADS tetrasodiuma blocks recombinant P2X1, -2, -3, -5 with IC50s ranging from 1 to 2.6 μM. PPADS tetrasodiuma blocks native P2Y2-like (IC50~0.9 mM) and recombinant P2Y4 (IC50~15 mM) receptors. PPADS tetrasodiuma is an inhibitor of the reverse mode of the Na/Ca2+ exchanger in guinea pig airway smooth muscle.
P2X Receptor   Na+/Ca2+ Exchanger  
Neurological, Eye or Ear Disease  
10
HY-N0738 Stachydrine hydrochloride
Stachydrine hydrochloride is the major active constituent of Leonurus artemisia, which is a potential therapy for cardiovascular diseases. Stachydrine can inhibit the NF-κB signal pathway. Anti-hypertrophic activities.
NF-κB   Endogenous Metabolite  
Breast Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   Cardiovascular Disease   Obesity  
9
HY-N0603 20(S)-Ginsenoside Rg3
20(S)-Ginsenoside Rg3 is the main component of Panax ginseng C. A. Meyer. Ginsenoside Rg3 inhibits Na+ and hKv1.4 channel with IC50s of 32.2±4.5 and 32.6±2.2 μM, respectively. 20(S)-Ginsenoside Rg3 also inhibits Aβ levels, NF-κB activity, and COX-2 expression.
Sodium Channel   Potassium Channel   NF-κB   COX   Amyloid-β   Endogenous Metabolite  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   SARS-CoV-2 Infection   Alzheimer's Disease   Obesity   Rheumatoid Arthritis  
9
HY-N0172 Caffeic acid
Caffeic acid is an inhibitor of both TRPV1 ion channel and 5-Lipoxygenase (5-LO).
TRP Channel   Lipoxygenase   Endogenous Metabolite  
Inflammation or Immune System Disease   Prostate Cancer   Pain   SARS-CoV-2 Infection  
9
HY-B2156 Menaquinone-4
Menaquinone-4 is a vitamin K, used as a hemostatic agent, and also a adjunctive therapy for the pain of osteoporosis.
Endogenous Metabolite  
Cancer  
8
HY-112461A NF449 octasodium
NF449 octasodium is a highly potent P2X1 receptor antagonist, with IC50s of 0.28, 0.69, and 120 nM for rP2X1, rP2X1+5, P2X2+3, respectively. NF449 octasodium is a Gsα-selective G Protein antagonist. NF449 octasodium suppresses the rate of GTP[γS] binding to Gsα-s, inhibits the stimulation of adenylyl cyclase activity, and blocks the coupling of β-adrenergic receptors to Gs.
P2X Receptor  
Cardiovascular Disease  
7
HY-148800 Suzetrigine
Suzetrigine (VX-548) is an orally active and highly selective NaV1.8 inhibitor that acts as an analgesic. Suzetrigine is also a blocker of sodium channel protein type 10 subunit alpha. Suzetrigine is promising for research of acute pain after abdominoplasty and bunionectomy.
Sodium Channel  
Neurological, Eye or Ear Disease  
7
HY-N0826 Corynoline
Corynoline is an orally active acetylcholinesterase (AChE) inhibitor with an IC50 of 30.6 μM. Corynoline exhibits multiple activities including anti-inflammatory, antinociceptive, antitumor and analgesic effects. Corynoline can be used in the research of diseases such as tumors and inflammatory pain.
Cholinesterase (ChE)   Keap1-Nrf2   Heme Oxygenase (HO)   COX   NO Synthase   p38 MAPK   JNK   Apoptosis   Bcl-2 Family   Caspase   STAT   Interleukin Related  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
6
HY-B1661 Hexamethonium chloride
Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.
Biochemical Assay Reagents  
Blood or Cardio-cerebrovascular Disease  
5
HY-122575 Aurintricarboxylic acid
Aurintricarboxylic acid is a nanomolar-potency, allosteric antagonist with selectivity towards αβ-methylene-ATP-sensitive P2X1Rs and P2X3Rs, with IC50s of 8.6 nM and 72.9 nM for rP2X1R and rP2X3R, respectively. Aurintricarboxylic acid is a potent anti-influenza agent by directly inhibiting the neuraminidase. Aurintricarboxylic acid is an inhibitor of topoisomerase II and apoptosis. Aurintricarboxylic acid is a selective inhibitor of the TWEAK-Fn14 signaling pathway. Aurintricarboxylic acid also acts as a cystathionine-lyase (CSE) inhibitor with an IC50 of 0.6 μM. Aurintricarboxylic acid is a modifier of miRNAs that regulate miRNA function, with an IC50 of 0.47 µM.
P2X Receptor   Influenza Virus   Topoisomerase   MicroRNA   Apoptosis  
Neurological, Eye or Ear Disease   Digestive System Disease   Lung Cancer   Leukemia/Lymphoma/Myeloma   Viral Infection   Digestive System Inflammation  
5
HY-N2258 Poncirin
Poncirin is isolated from Poncirus trifoliata with anti-inflammory activites. Poncirin significantly reduces mechanical hyperalgesia and allodynia in Complete Freund’s Adjuvant (CFA)-induced inflammatory pain models.
Apoptosis  
Digestive System Disease   Digestive System Inflammation  
4
HY-101911 5-BDBD
5-BDBD, a potent and selective P2X4 receptor antagonist, inhibits rP2X4R-mediated currents, with an IC50 of 0.75 μM. 5-BDBD completely blocks the basal and acute hyperalgesia induced by nitroglycerin (NTG).
P2X Receptor  
Neurological, Eye or Ear Disease  
4
HY-N6691 Veratridine
Veratridine (3-Veratroylveracevine) is a plant neurotoxin, a voltage-gated sodium channels (VGSCs) agonist. Veratridine inhibits the peak current of Nav1.7, with an IC50 of 18.39 µM. Veratridine regulates sodium ion channels mainly by activating sodium ion channels, preventing channel inactivation and increasing sodium ion flow.
Sodium Channel  
Neurological, Eye or Ear Disease  
4
HY-P0190A Iberiotoxin TFA
Iberiotoxin (TFA) is a selective high conductance high conductance Ca2+-activated K+ channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels.
Potassium Channel  
3
HY-P0190 Iberiotoxin
Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high conductance Ca2+-activated K+ channel inhibitor with a Kd of ~1 nM. Iberiotoxin does not block other types of voltage-dependent ion channels.

Source: Buthus tamulus

Potassium Channel  
Blood or Cardio-cerebrovascular Disease  
3
HY-W004260 Arachidic acid
Arachidic acid is an orally bioavailable membrane fluidity modulator and receptor/ion channel effector. Arachidic acid does not activate arachidonic acid-sensitive K+ channels in rat midbrain and hypothalamic neurons. Arachidic acid alleviates age-related spatial cognitive impairment. Arachidic acid is applicable for research related to age-related spatial cognitive impairment.

Source: Bee Pollen

Endogenous Metabolite  
Neurodegenerative Disease  
3
HY-P99575 Tarlatamab
Tarlatamab (AMG-757) is a bispecific T-cell engager (BiTE) antibody targeting delta-like ligand 3 (DLL3). DLL3 is a target that is selectively expressed in small-cell lung cancer (SCLC) tumors, but with minimal normal tissue expression. Tarlatamab has the KDs of 0.64 nM and 0.50 nM for human and nonhuman primate (NHP) DLL3, respectively. Tarlatamab has the KDs of 14.9 nM and 12 nM for human and NHP CD3, respectively. Tarlatamab is a first-in-class HLE BiTE immuno-oncology therapy targeting DLL3 and has the potential for SCLC research.

Species: Human

Notch  
Inflammation or Immune System Disease   Respiratory Disease   Small Cell Lung Cancer  
3
HY-P0062 Ziconotide
Ziconotide (SNX-111), a peptide, is a potent and selective block of N-type calcium channels antagonist. Ziconotide reduces synaptic transmission, and can be used for chronic pain research.
Calcium Channel  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
2
HY-P0062A Ziconotide TFA
Ziconotide TFA (SNX-111 TFA), a peptide, is a potent and selective block of N-type calcium channels antagonist. Ziconotide TFA reduces synaptic transmission, and can be used for chronic pain research.
Calcium Channel  
Cancer   Experimental Autoimmune Encephalomyelitis   Experimental Autoimmune Encephalomyelitis  
2
HY-P1242A NEP(1-40) TFA
NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.
Transmembrane Glycoprotein  
Inflammation or Immune System Disease  
2
HY-N6891 Hamaudol
Hamaudol is a chromone isolated from Saposhnikovia divaricata. Hamaudol shows significant inhibitory activity on cyclooxygenase (COX)-1 and COX-2 activities with IC50 values of 0.30, 0.57 mM, respectively, and has potent analgesia and anti-inflammary effects.
COX  
Colorectal Cancer   Prostate Cancer   Pancreatic Cancer   Depression   Rheumatoid Arthritis  
2
HY-N1478 Gardenoside
Gardenoside is an orally active natural compound found in Gardenia fruits. Gardenoside reliefs chronic constriction injury (CCI)-induced neuropathic pain by regulating the P2X3 and P2X7 receptors. Gardenoside has an inhibitory effect on free fatty acids (FFA)-induced cellular steatosis. Gardenoside reduces reactive oxygen species (ROS). Gardenoside can be used for anti-inflammatory, antinociceptive and hepatoprotective study.
P2X Receptor   Reactive Oxygen Species (ROS)  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
2
HY-14925 Lapaquistat
Lapaquistat (T-91485), a cholesterol biosynthesis inhibitor, is the active metabolite of Lapaquistat acetate (HY-16274). Lapaquistat can decrease statin-induced myotoxicity in lipid-lowering therapy.
Endogenous Metabolite   Drug Metabolite  
Metabolic or Endocrine Disease  
2
HY-P990071 Fepixnebart
Fepixnebart (LY3016859) is a humanized monoclonal hIgG4 antibody, which binds and neutralizes only TGFα and epiregulin with high affinity. Fepixnebart can be used for the study of diabetic nephropathy and broad-spectrum chronic pain, including diabetic peripheral neuropathic pain (DPNP), signs and symptoms of osteoarthritis (OA), and chronic low back pain (CLBP).

Species: Human

EGFR  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
2
HY-P1242 NEP(1-40)
NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.
Transmembrane Glycoprotein  
Inflammation or Immune System Disease  
2
HY-N2197 Hirsuteine
Hirsuteine is an indole alkaloid extracted from Uncaria rhynchophylla. Hirsuteine non-competitively antagonizes nicotine-mediated dopamine release by blocking ion permeation through nicotinic receptor channel complexes.
nAChR  
Neurological, Eye or Ear Disease  
2
HY-N6647 Luteolin-7-rutinoside
Luteolin-7-rutinoside has both anti-arthritic and antifungal activities, can result in a combination therapy for the treatment of fungal arthritis due to C. albicans infection.
Fungal  
Inflammation or Immune System Disease   Fungal Infection   Lung Fibrosis  
2
HY-113413 Imidazoleacetic acid
Imidazoleacetic acid (Imidazolyl-4-acetic acid) is a blood-brain barrier-permeable full agonist of the GABAA receptor. Imidazoleacetic acid forms via histamine oxidation in the mouse brain. Imidazoleacetic acid exerts multiple neurochemical and behavioral effects. Imidazoleacetic acid induces a range of centrally mediated effects, including analgesia, sedation, hypnosis, as well as reductions in blood pressure, body temperature, isolation-induced aggression and motor activity.
Endogenous Metabolite   GABA Receptor  
Metabolic or Endocrine Disease   Epilepsy   Pain   Hypertension  
2
HY-P99019 Fremanezumab
Fremanezumab (TEV-48125) is a humanized lgG2 monoclonal antibody that selectively and potently binds to calcitonin gene related peptide (CGRp) (IC50 values = 7.943 nM). Fremanezumab binds to mouse CGRP with an IC50 value of 19.6 nM. Fremanezumab counteracts anti-inflammatory effects of CGRP in vitro, including CGRP-mediated inhibition of LPS (HY-D1056)-induced microglial activation. Fremanezumab selectively inhibits the activation of Aδ meningeal nociceptors by cortical spreading depression (CSD) in rats. Fremanezumab can be used for the study of inflammation and chronic migraine.

Species: Human

CGRP Receptor  
Inflammation or Immune System Disease   Pain  
2
HY-P1241 BAM(8-22)
BAM(8-22), a proteolytically cleaved product of proenkephalin A and sensory neuron-specific receptor (SNSR) agonist, is a potent activator of Mas-related G-protein-coupled receptors (Mrgprs), MrgprC11 and hMrgprX1. BAM(8-22) induces scratching in mice in an Mrgpr-dependent manner. In addition, BAM(8-22) has an analgesic effect and can also inhibit the activation of microglia.
Mas-related G-protein-coupled Receptor (MRGPR)  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
2
HY-P0062B Ziconotide acetate
Ziconotide acetate (SNX-111 acetate), a peptide, is a potent and selective block of N-type calcium channels antagonist. Ziconotide acetate reduces synaptic transmission, and can be used for chronic pain research.
Calcium Channel  
Cancer   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
2
HY-P99221 Tanezumab
Tanezumab (RN-624) is a humanized anti-NGF mAb with high affinity and specificity. Tanezumab blocks NGF binding to its receptors, p75 and TrkA, in the peripheral nervous system. Tanezumab can be used in studies of acute and chronic pain such as osteoarthritis, knee and neuralgia, as well as post-herpetic neuralgia.

Species: Human

Trk Receptor  
Inflammation or Immune System Disease   Pain  
2
HY-N1219 Stephanine
Stephanine ((-)-Stephanine) is an isoquinoline aporphine-type alkaloid. Stephanine induce apoptosis through the reverse of mitotic exit. Stephanine exhibits Antiplasmodial activity. Stephanine can be used for the research of stomach pain, abdominal pain, arthritis and cancer.
Apoptosis   Parasite  
Cancer   Infection   Inflammation or Immune System Disease  
1
HY-P1441 Mambalgin 1
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation.
Sodium Channel  
1
HY-P0244A Dermorphin TFA
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain.

Source: the skin of an Amazonian frog

Opioid Receptor  
Neurological, Eye or Ear Disease  
1
HY-W795960 D-myo-Inositol 1,4,5-trisphosphate sodium salt
D-myo-inositol 1,4,5-trisphosphate sodium salt is a widely distributed intracellular second messenger. D-myo-inositol 1,4,5-trisphosphate sodium salt acts as a potent agonist of the Ins (1,4,5) P3 receptor with an EC50 of 0.12 μM and inhibits bovine PLC-δ1, with an IC50 of 5.4 μM for binding and an IC50 of 12.4 μM for hydrolysis. D-myo-inositol 1,4,5-trisphosphate sodium saltis metabolized into Ins (1,4) P2 and Ins (1,3,4,5) P4. D-myo-inositol 1,4,5-trisphosphate sodium salt mediates various cellular processes, including growth, development, fertilization, secretion, contraction and neuromodulation. D-myo-inositol 1,4,5-trisphosphate sodium salt inhibits PIP2 hydrolysis and Ca2+-ATPase activity. D-myo-inositol 1,4,5-trisphosphate sodium salt is used for cardiac preconditioning, exerts cardioprotective effects and mimics ischemic preconditioning. D-myo-inositol 1,4,5-trisphosphate sodium salt is applied in studies related to intracellular calcium and phosphoinositol signaling pathways.
Biochemical Assay Reagents   Calcium Channel   Phospholipase  
Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
1
HY-D0914A Fast green FCF free acid
Fast green FCF free acid is a dye that is acid-resistant. Fast Green FCF free acid inhibits α-synuclein aggregation, as well as Aβ, P2X4 receptor and TLR4/Myd88/NF-κB. Fast Green FCF free acid is widely used as a staining agent like quantitative stain for histones at alkaline pH after acid extraction of DNA, and as a protein stain in electrophoresis. Fast Green FCF free acid improves cognitive impairment, depression, relieves pain allergies, and promotes reproductive function.
α-synuclein  
Neurological, Eye or Ear Disease  
1
HY-Y1325E Sodium acetate trihydrate, United States Pharmacopeia (USP) Reference Standard
Sodium acetate trihydrate, United States Pharmacopeia (USP) Reference Standard (Sodium acetate trihydrate (Pharmaceutical primary standard, USP)) is a carboxylic acid and short-chain fatty acid (SCFAs). Sodium acetate trihydrate activates AMPK, increases ROS, cleaved caspase 9, PPARα, downregulates SREBP-1c, ChREBP expression. Sodium acetate trihydrate exhibits antifungal activity against Saccharomyces cerevisiae W303-1A. Sodium acetate trihydrate regulates energy metabolism. Sodium acetate trihydrate has anticancer activity against gastric cancer. Sodium acetate trihydrate induces writhing reaction and ulcerative colitis. Sodium acetate trihydrate can be used in the researches for gastric cancer, ulcerative colitis, hepatic steatosis, and pain.
Environmental Pollutants   Caspase   Reactive Oxygen Species (ROS)   Endogenous Metabolite   AMPK   Fungal   PPAR  
Gastric Cancer   Pain   Liver Disease   Colitis  
1
HY-P3431 VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
iGluR  
Neurological, Eye or Ear Disease  
1
HY-N4280 7,8-Dimethoxycoumarin
7,8-Dimethoxycoumarin is a coumarin compound derived from Artemisia caruifolia with oral activity. 7,8-Dimethoxycoumarin inhibits mitochondrial permeability transition pore and H+/K+-ATPase, and exhibits antioxidant, anti-inflammatory, renoprotective, neuroprotective and gastroprotective effects. 7,8-Dimethoxycoumarin reduces lipid peroxidation (TBARS), increases GSH levels, inhibits myeloperoxidase (MPO) activity, and regulates the expression of inflammatory factors by inhibiting the NF‑κB and MAPK pathways. 7,8-Dimethoxycoumarin ameliorates gastric mucosal injury, alleviates renal tissue lesions and relieves neuropathic pain. 7,8-Dimethoxycoumarin can be used in studies related to acute renal failure, trigeminal neuralgia and gastritis.
Na+/K+ ATPase   Glutathione Peroxidase   NF-κB   p38 MAPK   Interleukin Related  
Pain   Gastroenteritis   Renal Failure  
1
HY-P1441A Mambalgin 1 TFA
Mambalgin 1 TFA is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 TFA binds to closed/inactive channel. Mambalgin 1 TFA is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 TFA increases latency of withdrawal response in mouse tail-flick and paw-flick tests.
Sodium Channel  
Neurological, Eye or Ear Disease  
1
HY-N6028 Darutoside
Darutoside is an orally effective diterpene compound with significant anti-inflammatory, analgesic, wound healing promotion, and immunomodulatory activities. Darutoside reduces edema and pain responses by inhibiting the expression of COX-2 and the migration of inflammatory cells. It regulates macrophage polarization towards the M2 type by inhibiting the NF-κB pathway, alleviating inflammation and promoting wound healing. Through multi-target regulation of metabolic networks, Darutoside significantly alleviates acute gouty arthritis.
COX   NF-κB   Interleukin Related   TNF Receptor  
Inflammation or Immune System Disease  
1
HY-N0313 Euphol
Euphol is a tetracyclic triterpene alcohol isolated from the sap of Euphorbia tirucalli with anti-mutagenic, anti-inflammatory and immunomodulatory effects, orally active. Euphol inhibits the monoacylglycerol lipase (MGL) activity via a reversible mechanism (IC50=315 nM). MGL inhibition in the periphery modulates the endocannabinoid system to block the development of inflammatory pain.
MAGL   Endogenous Metabolite  
Inflammation or Immune System Disease  
1
HY-N1453 Hypocrellin B
Hypocrellin B, a pigment isolated from the fungi Hypocrella bambusae and Shiraia bambusicola, is an apoptosis inducer. Hypocrellin B can be used as a photosensitizer for photodynamic therapy of cancer. Hypocrellin B also has antimicrobial and antileishmanial activities.

Source: Hypocrella bambusae, Shiraia bambusicola

Apoptosis   Fungal   Parasite  
Infection  
1
HY-N0340 Scopolamine butylbromide
Scopolamine butylbromide (Hyoscine butylbromide) is an orally active anticholinergic agent and spasmolytic. Scopolamine butylbromide binds with high affinity to rat cardiac M2 (Ki 83 nmol/L), hM2 (Ki 233 nmol/L), rat intestinal M3 (Ki 290 nmol/L) and hM3 (Ki 643 nmol/L) muscarinic receptors. Scopolamine butylbromide exerts a dose-dependent antagonistic effect on Carbachol-induced gastrointestinal smooth muscle spasm. Scopolamine butylbromide can be used for the research of abdominal colic and pain associated with gastrointestinal spasm, functional abdominal pain, chronic gastropathy and gastric ulcer.
mAChR  
Pain   Experimental Autoimmune Encephalomyelitis   Gastric Ulcer   Muscle Relaxation and Spasm  
1
HY-15108G Purmorphamine (GMP)
Purmorphamine (GMP) is Purmorphamine (HY-15108) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. Purmorphamine is a smoothened/Smo receptor agonist with an EC50 of 1 μM.
Smo  
Cancer   Neurological, Eye or Ear Disease  
1
HY-N0172R Caffeic acid (Standard)
Caffeic acid (Standard) is the analytical standard of Caffeic acid. This product is intended for research and analytical applications. Caffeic acid is an inhibitor of both TRPV1 ion channel and 5-Lipoxygenase (5-LO).
Reference Standards   TRP Channel   Lipoxygenase   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
1
HY-P0244 Dermorphin
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain.

Source: skin of the frog Phyllomedusa sauvagei

Opioid Receptor  
Depression   Pain  
1
HY-N0885 Telocinobufagin
Telocinobufagin (Telobufotoxin; Telocinobufogenin) is an orally active bufadienolide with potential anti-tumor effects. Telocinobufagin exerts its anti-cancer effects on non-small cell carcinoma, osteosarcoma, thyroid cancer, breast cancer and head and neck squamous cell carcinoma by inhibiting the STAT3, JAK2/STAT3, LARP1-mTOR, PI3K/Akt/Snail and PLK1 pathways, and can also induce tumor cell apoptosis. Telocinobufagin enhances the Th1 immune response and protects against Salmonella typhimurium infection. Telocinobufagin has a strong cardiac-stimulating effect by inhibiting the activity of Na+/K+-ATPase, and it can promote renal fibrosis. Telocinobufagin demonstrates non-opioid analgesic effects in various acute pain models.

Source: toad

JAK   STAT   mTOR   PI3K   Akt   Polo-like Kinase (PLK)   Na+/K+ ATPase   Apoptosis   Bacterial  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Bacterial Infection   Pain   Digestive System Inflammation   Cardiovascular Disease   Non-Small Cell Lung Cancer   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
1
HY-N2071 Cedrol
Cedrol is a potent competitive inhibitor of cytochrome P-450(CYP) enzyme. Cedrol plays an anticancer role by inducing cell cycle arrest and Caspase-dependent apoptosis. Cedrol acts as a neutrophil agonist that can desensitize cells to subsequent stimulation of N-formyl peptides. Cedrol prevents neuropathic pain caused by chronic contractile injury by inhibiting oxidative stress and inflammation. In addition, Cedrol has antibacterial, hair loss prevention and anti-anxiety properties.
Environmental Pollutants   Fungal   Apoptosis   Platelet-activating Factor Receptor (PAFR)   Cytochrome P450   Caspase  
Cancer   Digestive System Disease   Bacterial Infection   Fungal Infection   Digestive System Inflammation   Parkinson's Disease  
1
HY-12664 AF64394
AF64394 is a GPR3 inverse agonist, with a pIC50 of 7.3.
Orphan GPCR  
1
HY-W250122 Glutamic acid sodium salt
Glutamic acid sodium salt (Monosodium glutamate) is an orally active food flavor enhancer. Glutamic acid sodium salt causes ROS generation, mitochondrial dysfunction, and Apoptosis. Glutamic acid sodium salt upregulates CHOP, Grp78, and Bcl-2. Glutamic acid sodium salt impairs cognition, induces depressive-like behavior, induces hyperalgesia, and induces obesity and insulin resistance. Glutamic acid sodium salt can be used to study neurotoxicity (e.g., brain damage, cognitive impairment), metabolic disorders (e.g., obesity, insulin resistance), hepatotoxicity, and renal toxicity, as well as pain-related disorders.
Biochemical Assay Reagents   Reactive Oxygen Species (ROS)   Mitochondrial Metabolism   Apoptosis   HSP   Bcl-2 Family  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
1
HY-160187 AAA
AAA is an orally active 20-HETE receptor antagonist. AAA exerts antihypertensive and organoprotective effects. AAA blocks 20-HETE prohypertensive actions, suppresses intrarenal and circulating angiotensin II levels, and interferes with renin-angiotensin system interactions. AAA attenuates development of, and reverses established, ANG II (HY-13948)-dependent malignant hypertension. AAA reduces albuminuria, glomerulosclerosis, and cardiac hypertrophy linked to malignant hypertension. AAA can be used for the research of malignant hypertension.
Orphan GPCR   Angiotensin Receptor  
Hypertension  
1
HY-P99144A Anti-Mouse PD-1 Antibody (S-5001)
Anti-Mouse PD-1 Antibody (S-5001) is a selective inhibitor targeting PD-1, blocking the PD-1/PD-L1 immune checkpoint axis through competitive binding to PD-1. Anti-Mouse PD-1 Antibody (S-5001) works by reversing the tumor immunosuppressive microenvironment and reactivating the anti-tumor activity of cytotoxic T lymphocytes. It can be used in research on tumors such as melanoma and HPV-positive oropharyngeal squamous cell carcinoma. Anti-Mouse PD-1 Antibody (S-5001) is often combined with photothermal therapy, chemotherapy, etc., to enhance efficacy.

Species: Mouse

PD-1/PD-L1  
Cancer Immunology   Immunotherapy for Melanoma   Squamous Cell Carcinoma  
1
HY-Y0537E Potassium chloride, for cell culture
Potassium chloride, for cell culture is potassium chloride that can be used for cell culture. Potassium chloride, for cell culture increases extracellular potassium ion concentration to induce cellular depolarization, thereby activating voltage-gated calcium channels and regulating intracellular calcium signaling. Potassium chloride, for cell culture upregulates Brn-5. Potassium chloride, for cell culture inhibits the proliferation of neurons and some plant cells.
Environmental Pollutants   Biochemical Assay Reagents   Potassium Channel   Calcium Channel  
Neurological, Eye or Ear Disease  
1
HY-D0914 Fast Green FCF
Fast Green FCF is a sea green triarylmethane food dye, with absorption maximum ranging from 622 to 626 nm. Fast Green FCF inhibits α-synuclein aggregation, as well as Aβ and P2X4 receptor, and TLR4/Myd88/NF-κB. Fast Green FCF is widely used as a staining agent like quantitative stain for histones at alkaline pH after acid extraction of DNA, and as a protein stain in electrophoresis. Fast Green FCF improves cognitive impairment, depression, relieves pain allergies, and promotes reproductive function.
Environmental Pollutants   α-synuclein  
Neurological, Eye or Ear Disease  
1
HY-101238 Agmatine sulfate
Agmatine sulfate exerts modulatory action at multiple molecular targets, such as neurotransmitter systems, ion channels and nitric oxide synthesis. It is an endogenous agonist at imidazoline receptor and a NO synthase inhibitor.
Imidazoline Receptor   NO Synthase   Endogenous Metabolite  
Cancer   Neurological, Eye or Ear Disease  
1
HY-W041892 Dimethyl itaconate
Dimethyl itaconate induces innate immune memory (trained immunity), and exhibits immunomodulatory property. Dimethyl itaconate inhibits the activation of microglia, reduces the neuroinflammation and synaptic structural damage. Dimethyl itaconate regulates the composition of intestinal flora.
Reactive Oxygen Species (ROS)  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
1
HY-P0170 TB500
TB500 is a synthetic version of an active region of thymosin β4. TB500 exhibits anti-fibrotic and wound healing activities by inhibiting the Akt signaling pathway and binding to actin. TB500 is claimed to promote endothelial cell differentiation, angiogenesis in dermal tissues, keratinocyte migration, collagen deposition and decrease inflammation.
Drug Derivative   Akt   P2X Receptor  
Inflammation or Immune System Disease  
1
HY-110004 ACEA
ACEA (short for arachidonyl-2'-chloroacetamide) is a synthetic organic compound that acts as an agonist of the cannabinoid receptor CB1. It is a chemical that affects the endocannabinoid system in the body, which regulates various physiological processes such as appetite, pain perception, mood, and memory.
Cannabinoid Receptor  
1
HY-130777A AMP-PNP lithium hydrate
AMP-PNP (Adenylyl imidodiphosphate) lithium hydrate is a non-hydrolyzable ATP analog. AMP-PNP lithium hydrate binds to ATP binding sites competely but is not hydrolyzed by enzymes, providing stable experimental conditions for studying ATP-dependent processes. AMP-PNP lithium hydrate can also be used to study enzyme activity, kinase regulation, DNA/RNA metabolism, ion channel function, and protein complex assembly.
Drug Derivative  
Metabolic or Endocrine Disease  
1
HY-P85890 Iba1 Antibody (YA5582)
Iba1 Antibody (YA5582) is a Mouse-derived and non-conjugated IgG1 monoclonal antibody, targeting to Iba1.

Host: Mouse; Reactivity: Human, Mouse, Rat

Monoclonal Antibodies Primary Antibodies

1
HY-B1057S Nefopam-d3 hydrochloride
Nefopam-d3 (hydrochloride) is the deuterium labeled Nefopam hydrochloride. Nefopam hydrochloride (Fenazoxine hydrochloride) is a centrally-acting but non-opioid analgesic drug, for the relief of moderate to severe pain. Nefopam hydrochloride targets β-catenin protein level in mesenchymal cells in-vitro and in-vivo.
β-catenin  
Neurological, Eye or Ear Disease  
/
HY-139521S Doxepin-d3
Doxepin-d3 is the deuterated-labeled Doxepin (HY-B0725A). Doxepin is an orally active, blood-brain barrier penetrant tricyclic antidepressant with multiple activities including hypnosis, sedation, analgesia and vasodilation. Doxepin enhances the expression of PSD-95 and synapsin 1 via the PI3K/AKT/mTOR signaling pathway, and is metabolized to Desmethyldoxepin in vivo. Doxepin can be used in research related to various diseases such as depression, anxiety, obesity and atopic dermatitis.
Isotope-Labeled Compounds   Akt   mTOR   Drug Intermediate  
Depression   Atopic Dermatitis   Obesity  
/
HY-P5172 MitTx-alpha
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-W018772S D-Ribose-18O
D-Ribose-18O is the 18O labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein glycati
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-P992345 DS002
DS002 is a human monoclonal antibody targeting NGF/bNGF, with an IC50 of 6.60 nM against human NGF, 1.98 nM against rat NGF, and 8.46 nM against mouse NGF. DS002 blocks NGF-TrkA binding, interrupts pain signal transduction, inhibits TrkA-mediated downstream signaling pathways, and alters aromatic amino acid metabolic pathways. DS002 inhibits cancer cell proliferation. DS002 exerts a preventive effect on Paclitaxel-, Cisplatin- and Vincristine-induced peripheral neuropathy in rats. DS002 can be used in studies related to chronic pain and chemotherapy-induced peripheral neuropathy.

Species: Human

Trk Receptor  
Pain  
/
HY-N20337 Selaginella extract
Selaginella extract (Selaginella tamariscina extract) is an extract of Selaginella that can be used in pain research.
Others  
Pain  
/
HY-N7018 20-Hydroxyganoderic Acid G
20-Hydroxyganoderic Acid G is a lanostane triterpenoid obtained from the EtOH extract of fruiting bodies of the Ganoderma curtisii. 20-Hydroxyganoderic Acid G inhibits BV-2 microglia cells activated by LPS with an IC50 of 21.33 μM. 20-Hydroxyganoderic Acid G has therapeutic potential in the agent discovery of nerve inflammation diseases associated with microglia activated by LPS.
Others  
Inflammation or Immune System Disease  
/
HY-119447S Mavacoxib-d4
Mavacoxib-d4 is the deuterium labeled Mavacoxib. Mavacoxib is a selective, oral long-acting cyclooxygenase-2 (COX-2) inhibitor and a long-acting non-steroidal anti-inflammatory drug (NSAID). Mavacoxib is used to treat pain and inflammation associated with degenerative joint disease in dogs.
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-W018772S9 D-Ribose-d-3
D-Ribose-d-3 is the deuterium labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein g
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-P5345 KLA peptide
KLA peptide is a naturally occurring Antibiotic peptide that is nontoxic outside of cells but is toxic when it enters into the interior of targeted cells. KLA peptide can induce cell Apoptosis by disrupting mitochondrial membranes and activating Caspase. MG1-KLA, formed by the coupling of KLA peptide with MG1, can selectively induce apoptosis in pro-inflammatory microglia. KLA peptide can be used for the research of liver fibrosis. KLA peptide can be used for the research of neonatal hypoxic-ischemic encephalopathy.
Apoptosis   Antibiotic   Caspase   Mitochondrial Metabolism  
Infection   Cerebrovascular Disease   Hepatic Fibrosis  
/
HY-167855S 1’-Epi Gemcitabine hydrochloride-13C,15N2
1’-Epi Gemcitabine hydrochloride-13C,15N2 is the 13C- and 15N-labeled MRS4833 (HY-167855). MRS4833 (compound 15) is an orally active, potent, competitive P2Y14R antagonist with an of IC50 of 5.92 nM for hP2Y14R and an IC50 of 4.8 nM for mP2Y14R. MRS4833 reduces airway eosinophilia in a protease-mediated asthma model and reverses chronic neuropathic pain in a mouse CCI model.
Isotope-Labeled Compounds   P2Y Receptor  
Inflammation or Immune System Disease  
/
HY-W653905 Amantadine-d15 hydrochloride
Amantadine-d15 hydrochloride is deuterated labeled Amantadine. Amantadine (1-Adamantanamine) is an orally avtive and potent antiviral agent with activity against influenza A viruses. Amantadine inhibits several ion channels such as NMDA and M2, and also inhibits Coronavirus ion channels. Amantadine also has anti-orthopoxvirus and anticancer activity. Amantadine can be used for Parkinson's disease, postoperative cognitive dysfunction (POCD) and COVID-19 research.
Isotope-Labeled Compounds  
Cancer   Infection   Neurological, Eye or Ear Disease  
/
HY-W712539 Homodihydrocapsaicin II
Homodihydrocapsaicin II is a capsaicinoid with analgesic and anti-inflammatory effects, which is found in capsicum fruits. Homodihydrocapsaicin II is promising for research of inflammatory diseases and neuropathic pain.
Drug Derivative  
/
HY-D1528 MTSEA-Fluorescein
MTSEA-Fluorescein is a fluorescent probe that can be used for ion channel research.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-158220D Hyaluronic acid methacryloyl (MW 300000)
Hyaluronic acid methacryloyl (MW 300000) (HAMA (MW 300000)), a natural extracellular matrix (ECM) with anti-inflammatory effects, promoting cell adhesion and proliferation. Hyaluronic acid methacryloyl (MW 300000) can be widely used in tissue engineering and regenerative medicine. Hyaluronic acid methacryloyl (MW 300000) can rapidly form a hydrogel after exposure to UV light.
Biochemical Assay Reagents  
Inflammation or Immune System Disease  
/
HY-137474 Purpurin 18 methyl ester
Purpurin 18 methyl ester, a chlorophyll-a derivative, is a photosensitizer that can be used in photodynamic therapy (PDT). Purpurin 18 methyl ester has photodynamic activity to induce cancer cell death.

Source: sponge Stelletta clavosa

Photosensitizer  
/
HY-P1330 Purotoxin 1
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp.
P2X Receptor  
Inflammation or Immune System Disease  
/
HY-N0131S1 Stigmasterol-d5-1
Stigmasterol-d5-1 is deuterium labeled Stigmasterol. Stigmasterol is a plant sterol which has been focused on the cholesterol-lowering activity and is valued as an anti-stiffness factor in the therapy of rheumatic diseases.
Isotope-Labeled Compounds   MMP   Endogenous Metabolite  
Inflammation or Immune System Disease  
/
HY-N19281 Puberulin
Puberulin is a coumarin compound and an orally effective analgesic. Puberulin is present in Choisya ternata var. Sundance. Puberulin exerts analgesic activity against chemical and heat-induced pain agents in mouse models, and this activity does not involve opioid receptors or muscarinic receptors. Puberulin can be used in the research of neuropathic pain.
Drug Derivative  
Pain  
/
HY-P10395 DP50
DP50 is a bifunctional compound that contains an opioid receptor (MOP) agonist and a neuropeptide FF receptor (NPFFR) antagonist. DP50 can be used in analgesia-related research.
Opioid Receptor   Neuropeptide FF Receptor  
Neurological, Eye or Ear Disease  
/
HY-B1837S Cyfluthrin-d6
Cyfluthrin-d6 (β-Cyfluthi-d6) is deuterium labeled Cyfluthrin. Cyfluthrin is a type II pyrethroid and has effects on various insects. Cyfluthrin is a modulator of Nav1.8 sodium channels by repetitive stimulation. Cyfluthrin can be applied in agriculture,veterinary, insecticide,pyrethroid and stored product.
Isotope-Labeled Compounds   Sodium Channel  
Infection  
/
HY-B0476S1 Phenacetin-13C
Phenacetin-13C is the 13C labeled Phenacetin. Phenacetin (Acetophenetidin) is a non-opioid analgesic/antipyretic agent. Phenacetin is a selective COX-3 inhibitor. Phenacetin is used as probe of cytochrome P450 enzymes CYP1A2 in human liver microsomes and in rats.
COX  
Inflammation or Immune System Disease  
/
HY-W264038 4-Fluorohippuric acid
4-Fluorohippuric acid is a major metabolite of flupirtine with research potential against pain and epilepsy.
Biochemical Assay Reagents  
Neurological, Eye or Ear Disease  
/
HY-17474AS Parecoxib-d5 sodium
Parecoxib-d5 sodium is the deuterium labeled Parecoxib sodium. Parecoxib Sodium (SC 69124A) is a highly selective and orally active COX-2 inhibitor, the proagent of Valdecoxib (HY-15762). Parecoxib Sodium is a nonsteroidal anti-inflammatory agent (NSAID) and inhibits prostaglandin (PG) synthesis. Parecoxib Sodium can be used for the relief of acute postoperative pain and symptoms of chronic inflammatory conditions such as osteoarthritis and rheumatoid arthritis in vivo.
Isotope-Labeled Compounds   COX  
Cancer   Inflammation or Immune System Disease  
/
HY-113413R Imidazoleacetic acid (Standard)
Imidazoleacetic acid (Standard) is the analytical standard of Imidazoleacetic acid (HY-113413). This product is intended for research and analytical applications. Imidazoleacetic acid (Imidazolyl-4-acetic acid) is a blood-brain barrier-permeable full agonist of the GABAA receptor. Imidazoleacetic acid forms via histamine oxidation in the mouse brain. Imidazoleacetic acid exerts multiple neurochemical and behavioral effects. Imidazoleacetic acid induces a range of centrally mediated effects, including analgesia, sedation, hypnosis, as well as reductions in blood pressure, body temperature, isolation-induced aggression and motor activity.
Reference Standards   Endogenous Metabolite   GABA Receptor  
Metabolic or Endocrine Disease   Epilepsy   Pain   Cardiovascular Disease  
/
HY-P991324 MEDI-7352
MEDI-7352 is a human bispecific antibody (bsAb) targeting NGF/bNGF & TNF. MEDI-7352 can be used in osteoarthritis (OA) pain research.

Species: Human

Trk Receptor   TNF Receptor  
Inflammation or Immune System Disease  
/
HY-P991270 MT204
MT204 is a humanized IgG1 antibody inhibitor targeting IL-2 of human and rhesus monkey origin. MT204 prevents soluble IL-2 from binding to intermediate-affinity IL-2 receptors and blocks CD25-bound IL-2 on high-affinity IL-2 receptors. MT204 has potently anti-proliferative activity with NKL cells and primary NK cells. MT204 has good tolerability and potent immunosuppressive activity in allogeneic skin graft model of rhesus monkey, promising for immunosuppressive and anti-proliferative therapy.

Species: Human

Interleukin Related  
Inflammation or Immune System Disease  
/
HY-N7126R Citronellal (Standard)
Citronellal (Standard) is the analytical standard of Citronellal. This product is intended for research and analytical applications.Citronellal is a monoterpene that can be found in the essential oils in various aromatic species of plants, with antiinflammatory and antinociceptive properties. Citronellal attenuates mechanical nociception, mediated in part by the NO-cGMP-ATP-sensitive K+ channel pathway. Citronellal induces reduction of spontaneuous activity, ataxia, analgesia, and sedation in vivo. Citronellal can attenuate mechanical nociception response in mouse model.
Reference Standards   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-P5907 Helianorphin-19
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-P5813 Cd1a
Cd1a is a β-toxin derived from the African spider Ceratogyrus darlingi. Cd1a can regulate calcium ion channels. Cd1a inhibits human calcium ion channels (Cav2.2)(IC502.6 μM) and mouse sodium ion channels (Nav1.7). Cd1a can be used in the development of peripheral pain treatment drugs .
Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-A0057AS2 Gabapentin-d4 hydrochloride
Gabapentin-d4 hydrochloride is the deuterium labeled Gabapentin hydrochloride (HY-A0057A). Gabapentin hydrochloride is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain.
Isotope-Labeled Compounds   Calcium Channel  
Cancer   Neurological, Eye or Ear Disease  
/
HY-N0340R Scopolamine butylbromide (Standard)
Scopolamine butylbromide (Standard) is the analytical standard of Scopolamine butylbromide (HY-N0340). This product is intended for research and analytical applications. Scopolamine butylbromide (Hyoscine butylbromide) is an orally active anticholinergic agent and spasmolytic. Scopolamine butylbromide binds with high affinity to rat cardiac M2 (Ki 83 nmol/L), hM2 (Ki 233 nmol/L), rat intestinal M3 (Ki 290 nmol/L) and hM3 (Ki 643 nmol/L) muscarinic receptors. Scopolamine butylbromide exerts a dose-dependent antagonistic effect on Carbachol-induced gastrointestinal smooth muscle spasm. Scopolamine butylbromide can be used for the research of abdominal colic and pain associated with gastrointestinal spasm, functional abdominal pain, chronic gastropathy and gastric ulcer.
Reference Standards   mAChR  
Neurological, Eye or Ear Disease   Gastric Disease  
/
HY-N18648 Piper methysticum extract
Piper methysticum extract extract is obtained from Piper methysticum, Piperaceae, and used to relax the body and mood, restore physical strength, and reduce pain. Piper methysticum extract is a more popular treatment of anxiety herb and is considered to be a non-addictive non-toxic herb. It has anti-anxiety, anti-fungal, anti-irritation, anti-inflammatory, soothing, sedative and other effects. It can effectively reduce the stimulation of skin neurons and inhibit the activation of NF-kB signal.
Fungal  
Experimental Autoimmune Encephalomyelitis   Experimental Autoimmune Encephalomyelitis  
/
HY-127003 Neoambrosin
Neoambrosin is a sesquiterpene lactone. Neoambrosin acts as a partial agonist of PPARγ and TRPA1 receptors, with no carbonic anhydrase inhibitory activity. Neoambrosin can be used in research on hypoglycemia, analgesia, anti-inflammation and anticancer effects.
PPAR   TRP Channel  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-B0364AS Dyclonine-d9 hydrochloride
Dyclonine-d9 hydrochloride (Dyclocaine-d9 hydrochloride) is the deuterated-labeled Dyclonine hydrochloride (HY-B0364A). Dyclonine hydrochloride (Dyclocaine hydrochloride) is an orally active, blood-brain barrier-permeable piperidine phenylacetone small molecule commonly used as a local anesthetic. Dyclonine hydrochloride acts as a highly selective allosteric antagonist of TRPV3; it also reversibly inhibits G9a, ALDH2 and ALDH3A1, non-competitively blocks AChE. Dyclonine hydrochloride activates the Nrf2/ARE pathway, relieves the epigenetic silencing of FXN, blocks Aβ42 aggregation, and promotes remyelination and reparative polarization of microglia. Dyclonine hydrochloride alleviates pruritus via TRPV3 inhibition; it is used in studies of neurodegenerative disease models based on its AChE inhibitory, antioxidant and remyelinating effects; it sensitizes drug-resistant tumors through ALDH inhibition, and combined use with protease inhibitors induces more tumor cell apoptosis; it inhibits Candida albicans in vitro. Dyclonine hydrochloride can be used for research on multiple diseases including neurodegenerative diseases, cancer and pruritic dermatitis.
Isotope-Labeled Compounds   TRP Channel   Aldehyde Dehydrogenase (ALDH)   Cholinesterase (ChE)   Keap1-Nrf2   Amyloid-β   Fungal   Apoptosis  
Cancer   Fungal Infection   Neurodegenerative Disease   Skin Inflammation  
/
HY-N20588 Erythrina variegata extract
Erythrina variegata extract is an extract of the erythrina tree (Erythrina variegata) that can be used to study arthritis pain.
Others  
/
HY-133115AS N-Desmethylnefopam-d5 hydrochloride
N-Desmethylnefopam-d5 (hydrochloride) is a deuterium labeled N-Desmethylnefopam hydrochloride. N-Desmethylnefopam hydrochloride is the main metabolite of Nefopam. N-Desmethylnefopam hydrochloride is a centrally-acting but non-opioid analgesic agent, for the relief of moderate to severe pain.
Isotope-Labeled Compounds   β-catenin  
Neurological, Eye or Ear Disease  
/
HY-12362G Val-cit-PAB-OH (GMP)
Val-cit-PAB-OH GMP is a GMP grade Val-cit-PAB-OH (HY-12362). GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Val-cit-PAB-OH is a degradable ADC linker.
ADC Linkers  
Cancer  
/
HY-B0619S1 Zaltoprofen-13C,d3
Zaltoprofen-13C,d3 is the 13C- and deuterium labeled Zaltoprofen. Zaltoprofen (CN100), a non-steroidal anti-inflammatory drug (NSAID), is a preferential and orally active COX-2 inhibitor, with IC50s of 1.3 and 0.34 μM for COX-1 and COX-2, respectively. Zaltoprofen exhibits powerful anti-inflammatory effects as well as an analgesic action on inflammatory pain.
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-17474S Parecoxib-d3
Parecoxib-d3 is the deuterium labeled Parecoxib. Parecoxib (SC 69124) is a highly selective and orally active COX-2 inhibitor, the proagent of Valdecoxib (HY-15762). Parecoxib Sodium is a nonsteroidal anti-inflammatory agent (NSAID) and inhibits prostaglandin (PG) synthesis. Parecoxib can be used for the relief of acute postoperative pain and symptoms of chronic inflammatory conditions such as osteoarthritis and rheumatoid arthritis in vivo.
Isotope-Labeled Compounds   COX  
Cancer   Inflammation or Immune System Disease  
/
HY-P2707 α-Dendrotoxin
α-Dendrotoxin (α-DTX) is a voltage-gated K+ channel blocker and an acid-sensing ion channel (ASIC) inhibitor. α-Dendrotoxin blocks Kv1.1, Kv1.2, Kv1.6 and D-type (ID) voltage-gated K+ channels, and reversibly inhibits slowly inactivating potassium currents. α-Dendrotoxin induces epilepsy-related behaviors in mice. α-Dendrotoxin can be used in studies related to tonic-clonic seizures.
Sodium Channel   Potassium Channel  
Epilepsy  
/
HY-P10560 M918
M918 is a cell-penetrating peptide. M918 is internalized by cells through endocytosis and can effectively penetrate a variety of cells in a non-toxic manner. M918 can be used in gene therapy and drug delivery system research.
Biochemical Assay Reagents  
/
HY-P10514 Transportan 10
Transportan 10 is a derivative of Transportan (HY-P1732) and is an amphiphilic cell penetrating peptide (CPP). Transportan 10 helps molecules penetrate cell membrane barriers by directly interacting with the lipid bilayer. Transportan 10 can be used in gene therapy or siRNA delivery vector research.
Small Interfering RNA (siRNA)  
/
HY-P10618 BTM-P1
BTM-P1 is a polycationic peptide that exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. BTM-P1 can form ion-permeable channels in the inner mitochondrial membrane to interfere with mitochondrial energy processes.
Bacterial  
/
HY-N6261 Epimagnolin B
Epimagnolin B is a bisepoxylignan isolated from Magnolia fargesii, with anti-inflammatory activity and antiallergic effects. Epimagnolin B inhibits NO production in LPS-activated microglia. Epimagnolin B exhibited antiallergic effects.
Others  
Inflammation or Immune System Disease  
/
HY-B0350AG Sodium butyrate (GMP)
Sodium butyrate (GMP) refers to Sodium butyrate (HY-B0350A) of GMP grade. Small molecules of GMP grade can be used as adjuvants in cell therapy. Sodium Butyrate (sodium butanoate) is an inhibitor of HDAC, possessing anti-tumor activity.
HDAC   Autophagy   Apoptosis   Endogenous Metabolite  
/
HY-N20206 Rhizoma anemones raddeanae extract
Rhizoma anemones raddeanae extract is an extract of Anemone raddeana Regel, used in research on joint pain and ulcer pain.
Others  
Pain  
/
HY-129724 α-MSH (11-13)
α-MSH (11-13) (ACTH-(11-13)) is a C-terminal tripeptide of α-MSH that can cross the blood-brain barrier. α-MSH (11-13) exhibits antipyretic, anti-inflammatory, and antibacterial activities. α-MSH (11-13) also exerts neuroprotective effects after traumatic brain injury by inhibiting excessive activation of microglia and reducing neuronal apoptosis. α-MSH (11-13) can be used in research related to traumatic brain injury, fever, and bacterial infections.
Melanocortin Receptor   Bacterial   NF-κB   Apoptosis   Interleukin Related  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P3223 Biphalin TFA
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-B2156S1 Menaquinone-4-13C6
Menaquinone-4-13C6 is the 13C-labeled Menaquinone-4. Menaquinone-4 is a vitamin K, used as a hemostatic agent, and also a adjunctive therapy for the pain of osteoporosis.
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer  
/
HY-B0563BS Ropivacaine-d7 hydrochloride
Ropivacaine-d7 hydrochloride is a deuterium labeled Ropivacaine (hydrochloride) (HY-B0563B). Ropivacaine hydrochloride is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is widely used for neuropathic pain management in vivo.
Isotope-Labeled Compounds   Sodium Channel   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-P991478 RLVT-14-02
RLVT-14-02 is a human monoclonal antibody (mAb) targeting MMP14. RLVT-14-02 can be used in neuropathic pain research.

Species: Human

MMP  
Neurological, Eye or Ear Disease  
/
HY-P0193 Nocistatin (Bovine)
Nocistatin (Bovine) is a nociceptin precursor contains another biologically active peptide. Nocistatin (Bovine) blocks nociception-induced allodynia and hyperalgesia. Nocistatin (Bovine) also attenuates pain evoked by prostaglandin E2. Nocistatin (Bovine) can bind to the membrane of mouse brain and spinal cord with high affinity. Nocistatin (Bovine) can be studied in research on pain transmission.
Biochemical Assay Reagents  
Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
/
HY-P11831 RD-pepcan-11
RD-pepcan-11 is a CB1 receptor agonist. RD-pepcan-11 increases the relative phosphorylation level of ERK1/2. RD-pepcan-11 mediates analgesic effects through interaction with CB1 receptors in a carrageenan-induced mouse inflammatory pain model. RD-pepcan-11 can be used in studies related to inflammatory pain.
Cannabinoid Receptor   PERK  
Inflammation or Immune System Disease  
/
HY-182539 DD04107
DD04107 is a neuronal exocytosis inhibitor with a rat Syt1-C2B domain binding Kd of 2.4 μM. DD04107 interferes with synaptobrevin-syntaxin-SNAP-25 complex formation and Syt1-SNARE complex interaction to block α-calcitonin gene-related peptide (α-CGRP) exocytotic release from primary sensory neurons. DD04107 blocks inflammatory ion channel recruitment to nociceptor plasma membranes. DD04107 can be used for the research of chronic inflammatory pain, neuropathic pain, osteosarcoma pain, chemotherapy-induced peripheral neuropathy, diabetic neuropathy, inflammatory pain.
CGRP Receptor  
Pain  
/
HY-N0488S2 Vincristine-d6 sulfate
Vincristine-d6 (sulfate) is the deuterium labeled Vincristine sulfate. Vincristine sulfate (Leurocristine; NSC-67574; 22-Oxovincaleukoblastine) is a microtubule inhibitor that disrupts microtubule polymerization by binding to β-tubulin (with a Ki of 85 nM in bovine), arrests the cell cycle and induces apoptosis. Vincristine sulfate inhibits cell replication, tumor blood flow and the proliferation of various cancer cells, while triggering effects such as oxidative stress, inflammation, calcium overload, epithelial-mesenchymal transition and peripheral neuropathic pain. Vincristine sulfate upregulates the expression of various transporters and nuclear receptors, and enriches gastric cancer stem-like cells. Vincristine sulfate is used in research related to various tumors including acute lymphoblastic leukemia, lymphoma, melanoma, gastric cancer, solid tumors and sarcomas.
Isotope-Labeled Compounds   Apoptosis   Mitosis   Microtubule/Tubulin  
Cancer  
/
HY-W751350 Cyclobenzaprine-d6
Cyclobenzaprine-d6 is the deuterium labeled Cyclobenzaprine. Cyclobenzaprine (MK130) hydrochloride is an orally active 5-HT2 receptor antagonist. Cyclobenzaprine hydrochloride acts centrally, providing skeletal muscle relaxation, alleviating muscle spasms, and reducing pain. Cyclobenzaprine hydrochloride also possesses antiparasitic activity. Cyclobenzaprine hydrochloride holds promise for research in the fields of acute, painful skeletal muscle disorders and infectious diseases.
Isotope-Labeled Compounds   Parasite   5-HT Receptor  
Infection   Neurological, Eye or Ear Disease  
/
HY-P1020 Nocistatin(human)
Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2.
Prostaglandin Receptor  
Neurological, Eye or Ear Disease  
/
HY-N18818 Arnica oil
Arnica oil can be used to relieve symptoms of inflammation and pain.
Others  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P11249 Mr1.1[S4Dap, C16Pen]
Mr1.1[S4Dap, C16Pen] is a highly active and selective nAChR (human α9α10 nAChR IC50 = 4.0 nM, rat α9α10 nAChR IC50 = 2.7 nM) inhibitor. Mr1.1[S4Dap, C16Pen] can significantly relieve pain and has significant stability. Mr1.1[S4Dap, C16Pen] can be used for the study of neuropathic pain.
nAChR  
Neurological, Eye or Ear Disease  
/
HY-D2317 HaloFlipper 30
HaloFlipper 30 is a fluorescent probe that covalently reacts with HaloTag fusion proteins to form an ester bond, which allows the probe to be stably attached to membrane structures. HaloFlipper 30 has high specificity, precision and good cell permeability.
Fluorescent Dye  
/
HY-P991210 Efzimfotase alfa
Efzimfotase alfa (ALXN-1850) is enzyme replacement therapy agent targeting the deficiency of tissue-nonspecific alkaline phosphatase (TNSALP). Efzimfotase alfa functions by hydrolyzing the substrates of TNSALP, reducing the concentrations of substrates such as inorganic pyrophosphate (PPi) and pyridoxal 5′-phosphate (PLP). Efzimfotase alfa is promising for research of hypophosphatasia (HPP).
Phosphatase  
Blood or Cardio-cerebrovascular Disease  
/
HY-B1057S1 Nefopam-d4 hydrochloride
Nefopam-d4 (hydrochloride) is deuterium labeled Nefopam (hydrochloride). Nefopam hydrochloride (Fenazoxine hydrochloride) is a centrally-acting but non-opioid analgesic drug, for the relief of moderate to severe pain. Nefopam hydrochloride targets β-catenin protein level in mesenchymal cells in-vitro and in-vivo.
Isotope-Labeled Compounds   β-catenin  
Neurological, Eye or Ear Disease  
/
HY-B0763S1 Ibudilast-d7
Ibudilast-d7 is the deuterium labeled Ibudilast. Ibudilast (KC-404; AV-411; MN-166) is a cyclic AMP phosphodiesterase (PDE) inhibitor. Ibudilast has platelet anti-aggregatory effects. Ibudilast can be used for the research of asthma for its inhibitory effects on tracheal smooth muscle contractility. Ibudilast may be a useful neuroprotective and anti-dementia agent counteracting neurotoxicity in activated microglia.
Isotope-Labeled Compounds   Phosphodiesterase (PDE)  
Cancer   Inflammation or Immune System Disease  
/
HY-135731AS 4-Methylamino antipyrine-d3 hydrochloride
4-Methylamino antipyrine-d3 (hydrochloride) is deuterium labeled 4-Methylamino antipyrine (hydrochloride). 4-Methylamino antipyrine hydrochloride is an active metabolite of Metamizole. Metamizole is a pyrazolone non-steroidal anti-inflammatory drug (NSAID) and inhibits COX. Metamizole is an nonopioid analgesic agent and can be used for pain and fever. 4-Methylamino antipyrine hydrochloride has analgesic, antipyretic, and relatively weak antiinflammatory properties.
Isotope-Labeled Compounds   COX   Drug Metabolite  
Inflammation or Immune System Disease  
/
HY-W040073S Nifurtimox-d4
Nifurtimox-d4 is deuterium labeled Nifurtimox. Nifurtimox, an antiprotozoal agent, which is generally used for the treatment of infections with Trypanosoma cruzi, has been used in the therapy of neuroblastoma. Nifurtimox affects enzyme activity of lactate dehydrogenase (LDH).
Isotope-Labeled Compounds   Parasite   Lactate Dehydrogenase  
Cancer   Infection  
/
HY-P4309 H-Gly-Tyr-Gly-OH
H-Gly-Tyr-Gly-OH, a tyrosine tripeptide, can be found in structural and transport proteins such as collagen and ion channels.
Others  
/
HY-B0517S Mepivacaine-d3
Mepivacaine-d3 is the deuterium labeled Mepivacaine. Mepivacaine is an amide-type local anesthetic agent. Mepivacaine binds to specific voltage-gated sodium ion channels in neuronal cell membranes, which inhibits both sodium influx and membrane depolarization.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-W721517 Gabapentin-d10
Gabapentin-d10 is the deuterium labeled Gabapentin (HY-A0057). Gabapentin is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain.
Isotope-Labeled Compounds   Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-P4091A LSD acetate
LSD acetate is a peptide. LSD acetate can specifically recognize the lymphatics of C8161 melanoma, but it does not bind to the lymphatics of normal tissues or tumor blood vessels. When conjugated with a proapoptotic peptide, LSD acetate can reduce the number of tumor lymphatics. LSD acetate can be used in the research of targeted therapy and diagnosis of tumor lymphatics.
Biochemical Assay Reagents  
Cancer  
/
HY-B0763S2 Ibudilast-d7-1
Ibudilast-d7-1 is the deuterium labeled Ibudilast. Ibudilast (KC-404;AV-411;MN-166) is a cyclic AMP phosphodiesterase (PDE) inhibitor. Ibudilast has platelet anti-aggregatory effects. Ibudilast can be used for the research of asthma for its inhibitory effects on tracheal smooth muscle contractility. Ibudilast may be a useful neuroprotective and anti-dementia agent counteracting neurotoxicity in activated microglia.
Phosphodiesterase (PDE)  
Inflammation or Immune System Disease  
/
HY-B1319S1 Pramocaine-d9 hydrochloride
Pramocaine-d9 (Pramoxine-d9) hydrochloride is the d9-labeled Pramocaine hydrochloride (HY-B1319). Pramocaine hydrochloride is a topical surface anesthetic and antipruritic agent. Pramocaine hydrochloride reversibly inhibits voltage-gated sodium channel, reduces transmembrane permeability of sodium ions, stabilizes cell membranes, prevents depolarization, blocks action potential conduction, and inhibits peripheral slow C-fiber pathways associated with pain, pruritus and thermoception. Pramocaine hydrochloride can be used in research related to chronic pruritus, renal pruritus, atopic dermatitis, xerotic pruritus, uremic pruritus, and cutaneous hyperalgesia/pain.
Isotope-Labeled Compounds   Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-P10898 GeX-2
GeX-2 is a truncated analogue of αO-conotoxin. GeX-2 activates GABAB receptor. GeX-2 inhibits α9α10 nAChR and CaV2.2 channels. GeX-2 alleviates pain in the rat model of chronic constriction injury.
nAChR   Calcium Channel   GABA Receptor  
Neurological, Eye or Ear Disease  
/
HY-B1462S1 Chlorzoxazone-13C
Chlorzoxazone-13C is the 13C labeled Chlorzoxazone. Chlorzoxazone is a centrally acting muscle relaxant used to treat muscle spasm and the resulting pain or discomfort.
Cytochrome P450  
Inflammation or Immune System Disease  
/
HY-B0678S Metaxalone-d3
Metaxalone-d3 is the deuterium labeled Metaxalone. Metaxalone (AHR438; NSC170959) is an FDA-approved muscle relaxant. Metaxalone acts mainly on the central nervous system and achieves muscle relaxation by inhibiting polysynaptic reflex arcs. In addition, Metaxalone is an inhibitor of MAO-A, which has anti-inflammatory and antioxidant effects. Metaxalone inhibits IL-1β-induced inflammatory phenotype, modulates NF-κB and other related signaling pathways, and decreases MAO-A expression and activity in IL-1β-treated microglia.
Isotope-Labeled Compounds   NF-κB   PGC-1α  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P3445 Anrikefon
Anrikefon is a peripherally restricted kappa opioid receptor (KOR) agonist, with an IC50 of 0.54 nM, an EC50 of 2.41 pM, and a Ka of 0.068 nM against human KOR, and it exhibits high selectivity over μ and δ opioid receptors. Anrikefon exerts analgesic effects by inhibiting behaviors associated with inflammatory, postoperative and neuropathic pain, and also exerts antipruritic effects by reducing itch-related behaviors. Anrikefon can be used in research on pain, pruritus, and pruritus associated with chronic kidney disease.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-N2573 Corydalmine
Corydalmine (L-Corydalmine) inhibits spore germination of some plant pathogenic as well as saprophytic fungi. Corydalmine acts as an oral analgesic agent, exhibiting potent analgesic activity. Corydalmine alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway.
Fungal   CXCR  
Infection   Neurological, Eye or Ear Disease  
/
HY-W018772S7 D-Ribose-d-1
D-Ribose-d-1 is the deuterium labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein g
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-W016586R Acivicin (Standard)
Articaine (Standard) is the analytical standard of Articaine. This product is intended for research and analytical applications. Articaine (Hoe-045 free base) is an amide agent that can suppress or relieve pain. containing an ester group, reversibly binding to the α-subunit of the voltage-gated sodium channels within the inner cavity of the nerve, can provide effective pain relief. Articaine ameliorates LPS-induced acute kidney injury via inhibition of NF-κB activation and the NLRP3 inflammasome pathway.
Reference Standards   Parasite   γ-Glutamyl Transferase (GGT)  
Cancer   Infection  
/
HY-W015618R 2',4'-Dimethylacetophenone (Standard)
Nefopam (hydrochloride) (Standard) is the analytical standard of Nefopam (hydrochloride). This product is intended for research and analytical applications. Nefopam hydrochloride (Fenazoxine hydrochloride) is a centrally-acting but non-opioid analgesic drug, for the relief of moderate to severe pain. Nefopam hydrochloride targets β-catenin protein level in mesenchymal cells in-vitro and in-vivo.
Reference Standards   Endogenous Metabolite  
Metabolic or Endocrine Disease  
/
HY-B0740S3 Cyclobenzaprine-d3-1 hydrochloride
Cyclobenzaprine-d3-1 hydrochloride (MK130-d3-1 hydrochloride) is the deuterium labeled Cyclobenzaprine hydrochloride (HY-B0740). Cyclobenzaprine (MK130) hydrochloride is an orally active 5-HT2 receptor antagonist. Cyclobenzaprine hydrochloride acts centrally, providing skeletal muscle relaxation, alleviating muscle spasms, and reducing pain. Additionally, Cyclobenzaprine hydrochloride has antiprotozoal activity. Additionally, Cyclobenzaprine hydrochloride also possesses antiparasitic activity. Cyclobenzaprine hydrochloride holds promise for research in the fields of acute, painful skeletal muscle disorders and infectious diseases
Isotope-Labeled Compounds   5-HT Receptor   Parasite  
Infection   Neurological, Eye or Ear Disease  
/
HY-P5857 MmTx2 toxin
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain.
GABA Receptor  
Neurological, Eye or Ear Disease  
/
HY-P2579 Dafphedyn
Dafphedyn is an analogue of Dynorphin (1-13). Dafphedyn has diuretic and profound analgesia effects that can be antagonized by centrally administered Naltrexone (HY-76711) or Naloxone (HY-17417A).
Opioid Receptor  
Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
/
HY-171561G DOTAM-Maleimide triTFA (GMP)
DOTAM-Maleimide triTFA (GMP) is DOTAM-Maleimide triTFA (HY-171561) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. DOTAM-Maleimide triTFA is a bifunctional chelator.
Biochemical Assay Reagents  
/
HY-133115S N-Desmethylnefopam-d5
N-Desmethylnefopam-d5 is the deuterium labeled N-Desmethylnefopam (HY-133115). N-Desmethylnefopam is the main metabolite of Nefopam. N-Desmethylnefopam is a centrally-acting but non-opioid analgesic agent, for the relief of moderate to severe pain. Nefopam targets β-catenin protein level in mesenchymal cells in-vitro and in-vivo.
Isotope-Labeled Compounds   β-catenin  
Neurological, Eye or Ear Disease  
/
HY-B0161ES (±)-Duloxetine-d3 hydrochloride
(±)-Duloxetine-d3 (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research.
Isotope-Labeled Compounds   Serotonin Transporter  
Neurological, Eye or Ear Disease  
/
HY-P991323 MEDI-1912
MEDI-1912 is a human monoclonal antibody (mAb) targeting NGF/bNGF. MEDI-1912 inhibits signaling through TrkA and p75 receptors. MEDI-1912 can be used in chronic pain research.

Species: Human

Trk Receptor   Neurokinin Receptor  
Inflammation or Immune System Disease  
/
HY-P1160A Bay 55-9837 TFA
Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes.
GCGR  
Metabolic or Endocrine Disease  
/
HY-B1430S Butamben-d9
Butamben-d9 is the deuterium labeled Butamben. Butamben (Butyl 4-aminobenzoate) results in long-lasting relief from pain, without impairing motor function or other sensory functions.
Isotope-Labeled Compounds   Calcium Channel   Sodium Channel   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-B1221S Flufenamic acid-d4
Flufenamic acid-d4 is deuterium labeled Flufenamic acid. Flufenamic acid is a non-steroidal anti-inflammatory agent, inhibits cyclooxygenase (COX), activates AMPK, and also modulates ion channels, blocking chloride channels and L-type Ca2+ channels, modulating non-selective cation channels (NSC), activating K+ channels. Flufenamic acid binds to the central pocket of TEAD2 YBD and inhibits both TEAD function and TEAD-YAP-dependent processes, such as cell migration and proliferation.
Isotope-Labeled Compounds   COX   AMPK   Potassium Channel   Chloride Channel   Calcium Channel   Parasite  
Inflammation or Immune System Disease  
/
HY-16910G WIKI4 (GMP)
WIKI4 (GMP) is WIKI4 (HY-16910) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. WIKI4 is a potent tankyrase inhibitor.
Wnt  
Cancer   Blood or Cardio-cerebrovascular Disease  
/
HY-P5153 ProTx-III
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-P992012 CA1001
CA1001 is a small-molecule ZNF74 inhibitor and a peripherally restricted κ/δ dual opioid receptor agonist. CA1001 exhibits potent antitumor activity both in vitro and in vivo. CA1001, in combination with immune checkpoint inhibitors, significantly enhances tumor regression. CA1001 activates peripherally restricted κ/δ dual opioid receptors and exerts analgesic effects under conditions of inflammatory pain, neuropathic pain, and mechanical hyperalgesia. CA1001 can be used in research related to melanoma, mechanical hyperalgesia, neuropathic pain, and inflammatory arthritis pain.

Species: Human

Opioid Receptor  
Melanoma   Pain  
/
HY-P5121 γ-Fibrinogen 377-395
γ-Fibrinogen377-395 is a fibrinogen-derived inhibitory peptide, as well as fibrinogen epitope. γ-Fibrinogen377-395 blocks microglia activation and inhibits fibrin-Mac-1 interactions in vitro, and suppresses experimental autoimmune encephalomyelitis (EAE) in mice in vivo. γ-Fibrinogen377-395 can be used for research in multiple sclerosis (MS), and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Others  
Blood or Cardio-cerebrovascular Disease  
/
HY-P1129 AR-M1896
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain.
Neuropeptide Y Receptor  
Neurological, Eye or Ear Disease  
/
HY-P10767 MD01-67
MD01-67 is a selective macrocyclic compound targeting the neurotensin receptor type 2 (NTS2), with Ki of 2.9 nM. MD01-67 exhibits analgesic and tactile hypersensitivity reducing activity in rats acute/persistent/chronic inflammatory pain models.
Neurotensin Receptor  
Neurological, Eye or Ear Disease  
/
HY-16525 XEN-2174
XEN-2174 is a noradrenaline transporter (NET) inhibitor. XEN-2174 inhibits the reuptake of noradrenaline through non-competitive inhibition, increasing the concentration of noradrenaline in the synaptic cleft, thereby activating α2-adrenergic receptor at the spinal level and exerting analgesic effects. XEN-2174 exhibits long-lasting analgesic effects in models of neuropathic pain and postoperative pain in rats. XEN-2174 can be used in pain research.
Monoamine Transporter   Adrenergic Receptor  
Neurological, Eye or Ear Disease  
/
HY-W040430A (S)-Nornicotine hydrochloride
(S)-Nornicotine hydrochloride is a nicotine metabolite that crosses the blood-brain barrier. (S)-Nornicotine hydrochloride weakly inhibits human CYP2A6 with a Ki >300 μM. (S)-Nornicotine hydrochloride promotes dopamine release in rat striatal and nucleus accumbens slices and increases endogenous DOPAC overflow through a calcium-dependent nAChR pathway that is sensitive to Mecamylamine (HY-B1395A). (S)-Nornicotine hydrochloride reduces behavioral responses maintained by nicotine or sucrose, exerts analgesic effects in persistent inflammatory pain and neuropathic pain models, and enhances the analgesic effect of morphine. (S)-Nornicotine hydrochloride is useful for research on tobacco dependence and pain.
Drug Metabolite   Cytochrome P450   nAChR  
Pain  
/
HY-P5163 NMB-1
NMB-1 is a conopeptide analogue. NMB-1 selectively inhibits sustained mechanically activated currents in sensory neurons (IC50: 1 μM). NMB-1 inhibits mechanical pain. NMB-1 can be used for research of hearing and pressure-evoked pain.
Others  
Inflammation or Immune System Disease  
/
HY-P5811 Ceratotoxin-1
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-P10562 BMV Gag-(7−25)
BMV Gag-(7 25) is an arginine-rich peptide with cell-penetrating ability. BMV Gag-(7 25) can be used in drug delivery and gene therapy research.
TMV  
/
HY-W018772S6 D-Ribose-d
D-Ribose-d is the deuterium labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein gly
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-W050088S Isoxepac-d6
Isoxepac-d6 (HP 549-d6) is the deuterium labeled Isoxepac (HY-W050088). Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases.
Isotope-Labeled Compounds   Drug Derivative  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P11642 Sialorphin
Sialorphin is a neutral endopeptidase (NEP) and aminopeptidase N (APN) inhibitor that responds to androgen signals. Sialorphin blocks the degradation of endogenous opioid peptides and interacts with μ-, δ-, κ-opioid receptors. Sialorphin regulates the ERK/mTOR signaling pathway by inducing cell cycle arrest, enhancing ERK1/2 activity, and reducing the phosphorylation levels of mTOR, 4E-BP1, p70S6K; accordingly, Sialorphin exhibits antiproliferative activity against colorectal cancer, glioma and prostate cancer cells without cytotoxicity. In addition, Sialorphin also produces antinociceptive responses, regulates sexual behavior, relaxes corpus cavernosum smooth muscle, and alleviates experimental colitis. Sialorphin is also a copper (II) ion-binding ligand. Sialorphin has been used in mechanistic studies related to cancer, pain management and inflammatory bowel disease.
ERK   Androgen Receptor   Opioid Receptor   Enteropeptidase   mTOR   Aminopeptidase  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-116705G 2-Deoxy-2-fluoro-L-fucose (GMP)
2-Deoxy-2-fluoro-L-fucose (2-Fluorofucose) GMP is a fucosyltransferase inhibitor that inhibits core fucosylation modification in cells. 2-Deoxy-2-fluoro-L-fucose GMP promotes the production of defucosylated IgG1 antibodies in IgG1-expressing cell culture systems; it regulates the levels of inflammatory cytokines such as IL-1β, IL-6 and TGF-β in human induced pluripotent stem cell-derived microglia. 2-Deoxy-2-fluoro-L-fucose GMP can be used in the research of related diseases including dengue fever and Alzheimer's disease.
Glycosyltransferase  
Viral Infection   Alzheimer's Disease  
/
HY-N10458 Asperbisabolane L
Asperbisabolane L, a sesquiterpenoid, exerts the anti-inflammatory activity by inhibiting the NF-κB-activated pathway. Asperbisabolane L inhibits the translocation of NF-κB from cytoplasm to the nucleus. Asperbisabolane L also inhibits NO production in LPS-activated BV-2 microglia cells.

Source: Aspergillus sydowii

NF-κB  
Inflammation or Immune System Disease  
/
HY-N6691R Veratridine (Standard)
Veratridine (Standard) is the analytical standard of Veratridine. This product is intended for research and analytical applications. Veratridine (3-Veratroylveracevine) is a plant neurotoxin, a voltage-gated sodium channels (VGSCs) agonist. Veratridine inhibits the peak current of Nav1.7, with an IC50 of 18.39?μM. Veratridine regulates sodium ion channels mainly by activating sodium ion channels, preventing channel inactivation and increasing sodium ion flow.
Reference Standards   Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-P991325 CRB-0089
CRB-0089 is a human monoclonal antibody (mAb) targeting NGF/bNGF. CRB-0089 can be used in analgesia research.

Species: Human

Trk Receptor  
Inflammation or Immune System Disease  
/
HY-B1279AS Metamizole-d3 sodium
Metamizole-d3 sodium is the deuterium labeled Metamizole sodium. Metamizole sodium is a non-opioid compound with excellent analgesic and antipyretic effects. Metamizole sodium is a cyclooxygenase-3 (COX-3) inhibitor.
Isotope-Labeled Compounds   COX  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P10212 AVLX-125
AVLX-125 (UCCB01-125) is a PSD-95 and PDZ domain inhibitor with Kd value of 10 nM. AVLX-125 can be used in the study of inflammatory pain.
iGluR  
Neurological, Eye or Ear Disease  
/
HY-P3087 Tyr-W-MIF-1
Tyr-W-MIF-1 is an opioid tetrapeptide with opiate and antiopiate activity. Tyr-W-MIF-1 can induce analgesia.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-B1888AS Bromfenac-d4 sodium
Bromfenac-d4 (sodium) is deuterium labeled Bromfenac (sodium). Bromfenac sodium is a potent and orally active inhibitor of COX, with IC50s of 5.56 and 7.45 nM for COX-1 and COX-2, respectively. Bromfenac sodium is a brominated non-steroidal anti-inflammatory/analgesic agent (NSAID), and it is commonly used for the research of postoperative inflammation and pain following cataract surgery, and pseudophakic cystoid macular edema (CME).
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-14834AS Budiodarone-d10 tartrate
Budiodarone-d10 tartrate (ATI-2042-d10 tartrate) is the deuterium labeled Budiodarone tartrate (HY-14834A). Budiodarone (ATI-2042) tartrate is a chemical analogue of Amiodarone (HY-14187) with balanced, multiple cardiac ion channel (potassium, sodium and calcium channels) inhibiting activity. Budiodarone tartrate is an antiarrhythmic agent.
Isotope-Labeled Compounds   Calcium Channel   Sodium Channel   Potassium Channel  
Blood or Cardio-cerebrovascular Disease  
/
HY-P1336A Deltorphin I TFA
Deltorphin I TFA (Deltorphin 1 TFA; Deltorphin C TFA; [D-Ala2] Deltorphin I TFA) is a high-affinity, selective δ-opioid receptor agonist that targets the δ1 and δ2 opioid receptor subtypes. Deltorphin I TFA produces analgesic effects in the rat spinal cord. Deltorphin I TFA increases the pain threshold in rats. Deltorphin I TFA can be used in studies related to nociception (acute pain).
Opioid Receptor  
Pain  
/
HY-P10394 DP32
DP32 is a bifunctional compound that contains an opioid receptor (MOP) agonist and a neuropeptide FF receptor (NPFFR) antagonist. DP32 can be used in analgesia-related research.
Opioid Receptor   Neuropeptide FF Receptor  
Neurological, Eye or Ear Disease  
/
HY-P5874 Myr-TAT-CBD3
Myr-TAT-CBD3 is CRMP2-CaV2.2 interaction inhibitor. Myr-tat-CBD3 can significantly attenuate carrageenan-induced thermal hypersensitivity and reverse thermal hypersensitivity induced in a rat model of postoperative pain. Myr-TAT-CBD3 can be used to study inflammation and postoperative pain.
Calcium Channel  
Inflammation or Immune System Disease  
/
HY-P5899 Mambalgin-3
Mambalgin-3 is an acid-sensitive ion channel 1 (ASIC1) inhibitor. Mambalgin-3 can be used in the study of analgesia.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-155236 Ancistrotecine B
Ancistrotecine B (Compound 2) is a Nav1.7 channel inhibitor (IC50: 0.73 μM). Ancistrotecine B relieves inflammatory pain in mice.
Sodium Channel  
Inflammation or Immune System Disease  
/
HY-P1020A Nocistatin(human) TFA
Nocistatin (human) TFA blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2.
Prostaglandin Receptor  
Neurological, Eye or Ear Disease  
/
HY-W702016 Bupivacaine-d9 hydrochloride
Bupivacaine-d9 hydrochloride is the deuterium labeled Bupivacaine hydrochloride (HY-B0405A). Bupivacaine hydrochloride is a NMDA receptor inhibitor.Bupivacaine can block sodium, L-calcium, and potassium channels.Bupivacaine potently blocks SCN5A channels with the IC50 of 69.5 μM. Bupivacaine hydrochloride can be used for the research of chronic pain.
Sodium Channel  
Cancer  
/
HY-B1057S2 Nefopam-d3
Nefopam-d3 is a deuterium labeled Nefopam (Fenazoxine). Nefopam is a centrally-acting but non-opioid analgesic drug, and Nefopam targets β-catenin protein level in mesenchymal cells.
β-catenin  
Neurological, Eye or Ear Disease  
/
HY-P5061 Dynorphin A (1-13) amide
Dynorphin A (1-13) amide is an endogenous opioid peptide that antagonizes morphine-induced analgesia.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-W707708 N-(4-Ethoxyphenyl)acetamide-2,2,2-d3
N-(4-Ethoxyphenyl)acetamide-2,2,2-d3 is the deuterium labeled Phenacetin (HY-B0476). Phenacetin (Acetophenetidin) is a non-opioid analgesic/antipyretic agent. Phenacetin is a selective COX-3 inhibitor. Phenacetin is used as probe of cytochrome P450 enzymes CYP1A2 in human liver microsomes and in rats.
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-B0678S1 Metaxalone-d6
Metaxalone-d6 is deuterium labeled Metaxalone. Metaxalone (AHR438; NSC170959) is an FDA-approved muscle relaxant. Metaxalone acts mainly on the central nervous system and achieves muscle relaxation by inhibiting polysynaptic reflex arcs. In addition, Metaxalone is an inhibitor of MAO-A, which has anti-inflammatory and antioxidant effects. Metaxalone inhibits IL-1β-induced inflammatory phenotype, modulates NF-κB and other related signaling pathways, and decreases MAO-A expression and activity in IL-1β-treated microglia.
Isotope-Labeled Compounds   NF-κB   PGC-1α  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P5916 VSTx-3
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
Others   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-D2630 Cy3 HA MA (MW 3000)
Cy3 HA MA (MW 3000) is a hyaluronic acid methacrylate labeled with CY3 (HY-D0822). Cy3 HA MA (MW 3000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 550/570 nm).
Fluorescent Dye  
/
HY-17355BS Dexpramipexole-d3 dihydrochloride
Dexpramipexole-d3 ((R)-Pramipexole-d3) dihydrochloride is the deuterium labeled Dexpramipexole. Dexpramipexole ((R)-Pramipexole) dihydrochloride is an orally active, blood-brain barrier permeable mitochondrial protective agent. Dexpramipexole dihydrochloride upregulates the expression of Parkin, PINK1, GPX4 and FSP1; binds to mitochondrial F1/Fo-ATP synthase; blocks the Nav1.8 sodium channel; and inhibits the activation of the NLRP3 inflammasome. Dexpramipexole dihydrochloride induces mitophagy, inhibits ferroptosis, pyroptosis, apoptosis, neuroinflammation and eosinophilopoiesis; maintains mitochondrial function and redox homeostasis; reduces reactive oxygen species production; and decreases myocardial infarct size. Dexpramipexole dihydrochloride is applicable to studies on eosinophilic asthma, myocardial ischemia/reperfusion injury, sepsis-associated encephalopathy, analgesia, and more.
Reactive Oxygen Species (ROS)   Isotope-Labeled Compounds   Glutathione Peroxidase   Ferroptosis   Apoptosis   Sodium Channel   Mitophagy   Autophagy   ATP Synthase   NOD-like Receptor (NLR)   PINK1/Parkin  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-17474S1 Parecoxib-d5
Parecoxib-d5 (SC 69124-d5) is deuterium labeled Parecoxib. Parecoxib (SC 69124) is a highly selective and orally active COX-2 inhibitor, the proagent of Valdecoxib (HY-15762). Parecoxib Sodium is a nonsteroidal anti-inflammatory agent (NSAID) and inhibits prostaglandin (PG) synthesis. Parecoxib can be used for the relief of acute postoperative pain and symptoms of chronic inflammatory conditions such as osteoarthritis and rheumatoid arthritis in vivo.
Isotope-Labeled Compounds   COX  
Cancer   Inflammation or Immune System Disease  
/
HY-P99820 Ranevetmab
Ranevetmab (NV-01) is a caninised anti-NGF monoclonal antibody (mAb). Ranevetmab can alleviate pain, and is used for the research of degenerative joint disease (DJD) pain.

Species: Canlupfam

TNF Receptor  
Inflammation or Immune System Disease  
/
HY-W011777S Tricaine-d5 methanesulfonate
Tricaine-d5 methanesulfonate is the deuterium labeled Tricaine methanesulfonate (HY-W011777). Tricaine methanesulfonate (MS-222) is a commonly used agent that can suppress or relieve pain. agent for immobilization of aquatic species. Tricaine methanesulfonate, the most widely used agent that can suppress or relieve pain. in fish, has been shown to induce embryotoxic effects in zebrafish.
Isotope-Labeled Compounds  
Neurological, Eye or Ear Disease  
/
HY-D2651 Cy5 HA MA (MW 50000)
Cy5 HA MA (MW 50000) is a hyaluronic acid methacrylate labeled with CY5 (HY-D0821). Cy5 HA MA (MW 50000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 633/670 nm).
Fluorescent Dye  
/
HY-N1478R Gardenoside (Standard)
Gardenoside is an orally active natural compound found in Gardenia fruits. Gardenoside reliefs chronic constriction injury (CCI)-induced neuropathic pain by regulating the P2X3 and P2X7 receptors. Gardenoside has an inhibitory effect on free fatty acids (FFA)-induced cellular steatosis. Gardenoside reduces reactive oxygen species (ROS). Gardenoside can be used for anti-inflammatory, antinociceptive and hepatoprotective study.
Reference Standards   P2X Receptor   Reactive Oxygen Species (ROS)  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-N15269 Cyperol
Cyperol is a chemical component of the Nagarmotha (Cyperus rotundus). Nagarmotha possesses various pharmacological activities such as diuresis, digestion, menstruation, insect repellent, analgesia and anti-inflammatory.
Others  
/
HY-119521S Mexiletine-d3
Mexiletine-d3 (KOE-1173-d3) is deuterium labeled Mexiletine. Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research.
Isotope-Labeled Compounds  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-N0859B Schisanchinin D
Schisanchinin D is an NO release inhibitor found in the fruits of Schisandra chinensis. Schisanchinin D can inhibit the release of nitric oxide (NO) by lipopolysaccharide (LPS)-activated microglia in primary murine BV2 microglia cells. Schisanchinin D is promising for research of neurodegenerative diseases such as Alzheimer's disease (AD).
NO Synthase  
Neurological, Eye or Ear Disease  
/
HY-P2027 B 4310
B 4310 is a non-organ-selective Bradykinin antagonist. B 4310 induces uterine contraction in rats. B 4310 blocks bradykinin-mediated responses, including substance P release, plasma extravasation, venous contraction, prostaglandin E2 release and trigeminal nerve stimulation, but exerts no effect on angiotensin II, acetylcholine or capsaicin pathways. B 4310 exerts a reversible antagonistic effect on bradykinin-induced nociceptors. B 4310 serves as a tool for investigating the biological effects of bradykinin.
Bradykinin Receptor  
Female Reproductive System Disease   Hypotension  
/
HY-P991677 Efmirenpase alfa
Efmirenpase alfa is an Fc-ENPP1 fusion protein (human IgG1 Fc domain linked to a modified human ENPP1). Efmirenpase alfa has prolonged half-life and enhanced receptor affinity compared with native human ENPP1. Efmirenpase alfa can be used as an enzyme replacement therapy for ENPP1 deficiency such as arterial calcification and hypophosphatemic rickets research.

Species: Human

Phosphodiesterase (PDE)  
Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
/
HY-D2649 Cy5 HA MA (MW 5000)
Cy5 HA MA (MW 5000) is a hyaluronic acid methacrylate labeled with CY5 (HY-D0821). Cy5 HA MA (MW 5000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 633/670 nm).
Fluorescent Dye  
/
HY-B0763S Ibudilast-d3
Ibudilast-d3 (KC-404-d3) is the deuterium labeled Ibudilast. Ibudilast (KC-404) is a cyclic AMP phosphodiesterase (PDE) inhibitor. Ibudilast has platelet anti-aggregatory effects. Ibudilast can be used for the research of asthma for its inhibitory effects on tracheal smooth muscle contractility. Ibudilast may be a useful neuroprotective and anti-dementia agent counteracting neurotoxicity in activated microglia.
Isotope-Labeled Compounds   Phosphodiesterase (PDE)  
Cancer   Inflammation or Immune System Disease  
/
HY-D2681 Cy7 HA MA (MW 3000)
Cy7 HA MA (MW 3000) is a hyaluronic acid methacrylate labeled with CY7 (HY-D0825). Cy7 HA MA (MW 3000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 740/770 nm).
Fluorescent Dye  
/
HY-13681S Methylprednisolone acetate-d6
Methylprednisolone acetate-d6 is the deuterium labeled Methylprednisolone acetate (HY-13681). Methylprednisolone acetate, a prednisolone derivative, is a corticosteroid hormone. Methylprednisolone acetate can relieve pain and swelling that occurs with arthritis and other joint disorders in vivo.
Glucocorticoid Receptor   Isotope-Labeled Compounds  
Inflammation or Immune System Disease  
/
HY-N10782 Balanophonin
Balanophonin is an anti-inflammatory and anti-cancer agent. Balanophonin inhibits microglial activation and neurodegeneration via inhibiting activated microglia-induced apoptosis.
Apoptosis   COX   TNF Receptor   p38 MAPK  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-D2632 Cy3 HA MA (MW 10000)
Cy3 HA MA (MW 10000) is a hyaluronic acid methacrylate labeled with CY3 (HY-D0822). Cy3 HA MA (MW 10000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 550/570 nm).
Fluorescent Dye  
/
HY-D2633 Cy3 HA MA (MW 50000)
Cy3 HA MA (MW 50000) is a hyaluronic acid methacrylate labeled with CY3 (HY-D0822). Cy3 HA MA (MW 50000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 550/570 nm).
Fluorescent Dye  
/
HY-129283 Goralatide
Goralatide is a compound that regulates the thermal sensitivity of hematopoietic progenitor cells. It can reduce the thermal sensitivity of normal hematopoietic progenitor cells and increase the difference in thermal sensitivity between leukemia progenitor cells and normal progenitor cells, thereby increasing the inhibition window of hyperthermia therapy.
Ras  
/
HY-D2650 Cy5 HA MA (MW 10000)
Cy5 HA MA (MW 10000) is a hyaluronic acid methacrylate labeled with CY5 (HY-D0821). Cy5 HA MA (MW 10000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 633/670 nm).
Fluorescent Dye  
/
HY-D2634 Cy3 HA MA (MW 100000)
Cy3 HA MA (MW 100000) is a hyaluronic acid methacrylate labeled with CY3 (HY-D0822). Cy3 HA MA (MW 100000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 550/570 nm).
Fluorescent Dye  
/
HY-D2648 Cy5 HA MA (MW 3000)
Cy5 HA MA (MW 3000) is a hyaluronic acid methacrylate labeled with CY5 (HY-D0821). Cy5 HA MA (MW 3000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 633/670 nm).
Fluorescent Dye  
/
HY-119521S1 Mexiletine-d6
Mexiletine-d6 (KOE-1173-d6) is deuterium labeled Mexiletine. Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research.
Isotope-Labeled Compounds   Sodium Channel  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-16935S Mavatrep-d6
Mavatrep-d6 (JNJ-39439335-d6) is a deuterated labeled Mavatrep (HY-16935). Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (Ki=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca2+ influx with an IC50 value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain.
Isotope-Labeled Compounds   TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-101546A Cavidine
Cavidine ((+)-Cavidine) is an analgesic and anti-inflammatory agent. Cavidine can be isolated from Corydalis ternata f. yanhusuo (Y.H.Chou & Chun C.Hsu) Y.C.Zhu. Cavidine reduces the expression of inflammatory factors IL-1β, IL-6 and TNF-α, and inhibits calcium ion influx. Cavidine inhibits the phosphorylation of p38 and ERK1/2. Cavidine increases mechanical and thermal pain thresholds in chronic pain models. Cavidine can be used for the research of chronic pain.
p38 MAPK   ERK   Interleukin Related  
Inflammation or Immune System Disease   Chronic Pain  
/
HY-D2631 CY3 HA MA (MW 5000)
Cy3 HA MA (MW 5000) is a hyaluronic acid methacrylate labeled with CY3 (HY-D0822). Cy3 HA MA (MW 5000) is widely used in the fields of biolabeling and imaging, drug delivery and tissue engineering and regenerative medicine (Ex/Em = 550/570 nm).
Fluorescent Dye  
/
HY-N0388R Gelsemine (Standard)
Gelsemine (Standard) is the analytical standard of Gelsemine. This product is intended for research and analytical applications. Gelsemine, an alkaloid from the Chinese herb Gelsemium elegans, is effective in mitigating chronic pain. Antinociceptive effects.
Reference Standards   Others  
Neurological, Eye or Ear Disease  
/
HY-B0338S Rimantadine-d4 hydrochloride
Rimantadine-d4 (hydrochloride) is the deuterium labeled Rimantadine hydrochloride. Rimantadine is an orally active inhibitor for M2 protein, that blocks the hydrogen ion channel activity, prevents the entry and replication of the virus, and exhibits board-spectrum antiviral activity.
Isotope-Labeled Compounds   Influenza Virus   Autophagy  
Infection  
/
HY-N0488S1 Vincristine-d3-1 sulfate
Vincristine-d3 sulfate is the deuterium labeled Vincristine sulfate. Vincristine-1 sulfate (Leurocristine; NSC-67574; 22-Oxovincaleukoblastine) is a microtubule inhibitor that disrupts microtubule polymerization by binding to β-tubulin (with a Ki of 85 nM in bovine), arrests the cell cycle and induces apoptosis. Vincristine-1 sulfate inhibits cell replication, tumor blood flow and the proliferation of various cancer cells, while triggering effects such as oxidative stress, inflammation, calcium overload, epithelial-mesenchymal transition and peripheral neuropathic pain. Vincristine-1 sulfate upregulates the expression of various transporters and nuclear receptors, and enriches gastric cancer stem-like cells. Vincristine-1 sulfate is used in research related to various tumors including acute lymphoblastic leukemia, lymphoma, melanoma, gastric cancer, solid tumors and sarcomas.
Isotope-Labeled Compounds   Apoptosis   Mitosis   Microtubule/Tubulin  
Cancer  
/
HY-P11642A Sialorphin TFA
Sialorphin TFA is a neutral endopeptidase (NEP) and aminopeptidase N (APN) inhibitor that responds to androgen signals. Sialorphin TFA blocks the degradation of endogenous opioid peptides and interacts with μ-, δ-, κ-opioid receptors. Sialorphin TFA regulates the ERK/mTOR signaling pathway by inducing cell cycle arrest, enhancing ERK1/2 activity, and reducing the phosphorylation levels of mTOR, 4E-BP1, p70S6K; accordingly, Sialorphin TFA exhibits antiproliferative activity against colorectal cancer, glioma and prostate cancer cells without cytotoxicity. In addition, Sialorphin TFA also produces antinociceptive responses, regulates sexual behavior, relaxes corpus cavernosum smooth muscle, and alleviates experimental colitis. Sialorphin TFA is also a copper (II) ion-binding ligand. Sialorphin TFA has been used in mechanistic studies related to cancer, pain management and inflammatory bowel disease.
Enteropeptidase   Aminopeptidase   Opioid Receptor   ERK   mTOR   Androgen Receptor  
Digestive System Disease   Colitis  
/
HY-13506G M344 (GMP)
M344 (GMP) (D 237) (GMP) is the GMP level of M344 (HY-13506). GMP level of small molecules can be used as auxiliary reagents in cell therapy. M344 is a kind of histone acetylation enzyme inhibitor.
HDAC  
Cancer  
/
HY-B0402S1 Amantadine-d6
Amantadine-d6 is the deuterium labeled Amantadine. Amantadine (1-Adamantanamine) is an orally avtive and potent antiviral agent with activity against influenza A viruses. Amantadine inhibits several ion channels such as NMDA and M2, and also inhibits Coronavirus ion channels. Amantadine also has anti-orthopoxvirus and anticancer activity. Amantadine can be used for Parkinson's disease, postoperative cognitive dysfunction (POCD) and COVID-19 research.
Apoptosis   CDK   SARS-CoV   Bcl-2 Family   Influenza Virus   Orthopoxvirus  
Cancer  
/
HY-N1884 4',​7-​Di-​O-​methylnaringenin
4',​7-​Di-​O-​methylnaringenin ((−)-NRG-DM) is a flavonoid found in Renealmia alpinia. (−)-NRG-DM inhibits Nav1.7, Nav1.8 and Kv2.1 channels and has analgesic activity. Intraperitoneal administration of (−)-NRG-DM dose-dependently attenuated pain in a formalin-induced mouse inflammatory pain model and mustard oil-induced mouse colorectal pain model[2].
Sodium Channel   Potassium Channel  
/
HY-P2046 β-Endorphin (rat)
β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-B0725S Doxepin-d3 hydrochloride
Doxepin-d3 hydrochloride is the deuterated-labeled Doxepin Hydrochloride (HY-B0725). Doxepin Hydrochloride is an orally active, blood-brain barrier penetrant tricyclic antidepressant with multiple activities including hypnosis, sedation, analgesia and vasodilation. Doxepin Hydrochloride enhances the expression of PSD-95 and synapsin 1 via the PI3K/AKT/mTOR signaling pathway, and is metabolized to DesmethylDoxepin Hydrochloride in vivo. Doxepin Hydrochloride can be used in research related to various diseases such as depression, anxiety, obesity and atopic dermatitis.
Isotope-Labeled Compounds   Akt   mTOR   Drug Intermediate  
Depression   Atopic Dermatitis   Obesity  
/
HY-P3223A Biphalin acetate
Biphalin acetate, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores.Biphalin acetate has high affinity for opioid receptors. Biphalin acetate shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin acetate is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-N10386 Dichotomine B
Dichotomine B, a β-Carboline alkaloid, attenuates neuroinflammatory responses in LPS/ATP-induced BV2 microglia.
Others  
Inflammation or Immune System Disease  
/
HY-N8104 15a-Hydroxy-3,11,23-trioxo-lanost-8,20-dien-26-oic acid
15a-Hydroxy-3,11,23-trioxo-lanost-8,20-dien-26-oic acid, a Lanostane triterpenoid, possesses NO production inhibitory activities of LPS-induced microglia.

Source: Ganoderma curtisii

Others  
Inflammation or Immune System Disease  
/
HY-W018772S14 D-Ribose-d5
D-Ribose-d5 is the deuterium labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein gl
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-P991622 MNAC13
MNAC13 is a kind of mouse IgG1 chimeric antibody, targeting to human TrkA. MNAC13 inhibits the NGF dependent signaling pathway by specifically binding to TrkA receptors. MNAC13 has good analgesic effect and long-lasting efficacy. MNAC13 can be used for researches on inflammatory and chronic pain.

Species: Human

Trk Receptor  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P1346 APETx2
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.

Source: Anthopleura elegantissima

Sodium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-N3710 Dehydrocrenatidine
Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain.
JAK   Apoptosis  
Cancer   Neurological, Eye or Ear Disease  
/
HY-P991711 Povovetug
Povovetug is a humanized IgG1κ chimeric monoclonal antibody inhibitor targeting NGF/bNGF. Povovetug has a significant analgesic activity. Povovetug can be used for central neuroinflammation like chronic radicular pain research.

Species: Human

Trk Receptor  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-17357S Nepafenac-d5
Nepafenac-d5 (AHR-9434-d5; AL-6515-d5) is the deuterium labeled Nepafenac (HY-17357). Nepafenac, a nonsteroidal anti-inflammatory agent, is a topically administered COX-2 inhibitor with an IC50 of 0.12 μM. Nepafenac exhibits only weak COX-1 inhibitory activity (IC50 = 64.3 μM). Nepafenac possesses unique prodrug properties, which enable it to rapidly convert into the active metabolite Amfenac (HY-17479) in the ocular tissues, thereby achieving high concentrations in the retina and choroid. Nepafenac reduces inflammation and pain by inhibiting the activity of cyclooxygenase (COX) enzymes and thereby decreasing the production of prostaglandin PGE₂. Nepafenac can delay the metastasis of uveal melanoma (UM) in rabbit eyes. Nepafenac is mainly used for pain management and inflammation control after ophthalmic surgeries.
Isotope-Labeled Compounds   Prostaglandin Receptor   COX  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P991689 Girancitug
Girancitug is a humanized IgG1κ monoclonal antibody inhibitor targeting VEGFR2/KDR/CD309. Girancitug effectively inhibits angiogenesis. Girancitug can be used for anti-angiogenic therapy in cancers like colorectal and ovarian cancer research.

Species: Human

VEGFR  
Cancer  
/
HY-P4091 LSD
LSD is a peptide. LSD can specifically recognize the lymphatics of C8161 melanoma, but it does not bind to the lymphatics of normal tissues or tumor blood vessels. When conjugated with a proapoptotic peptide, LSD can reduce the number of tumor lymphatics. LSD can be used in the research of targeted therapy and diagnosis of tumor lymphatics.
Biochemical Assay Reagents  
Cancer  
/
HY-108449S Acoltremon-d3
Acoltremon-d3 (WS-12-d3) is the deuterium labeled Acoltremon (HY-108449). Acoltremon is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research.
Isotope-Labeled Compounds   TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-W000665 2,6-Dimethyl-L-tyrosine
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-P99748 Nadecnemab
Nadecnemab is an IgG4κ antibody targeting to GFRA3, glial cell derived neurotrophic factor family receptor alpha 3. Nadecnemab can be used for research of osteoarthritis of the knee/pain.

Species: Human

TGF-β Receptor  
Inflammation or Immune System Disease  
/
HY-P5914 Wasabi Receptor Toxin
Wasabi Receptor Toxin is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca2+ permeability. Wasabi Receptor Toxin causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation.
TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-P991294 MGTA-117 Antibody
MGTA-117 is a humanized monoclonal antibody targeting CD117. MGTA-117 can be used for synthesis of antibody-drug conjugate (ADC), utilizing an amanitin payload. MGTA-117 has potent anti-tumor activity and increases survival in three acute myeloid leukemia (AML) xenograft hNSG mice models (Kasumi-1, AML PDX 1 and AML PDX 2). MGTA-117 enables hematopoietic stem cell transplantation (HSCT) preprocessing in AML, myelodysplasia with excess blasts (MDS-EB) and gene therapy.

Species: Human

ADC Antibodies  
Cancer  
/
HY-P5786 Heteropodatoxin-1
Heteropodatoxin-1 (HpTx1), a spider peptide toxin, is a Kv4.2 current inhibitor. Heteropodatoxin-1 also inhibits Nav1.7 and activates Nav1.9 but does not affect Nav1.8.
Potassium Channel   Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-B0464S Hydralazine-d4 hydrochloride
Hydralazine-d4 hydrochloride is the deuterium labeled Hydralazine hydrochloride. Hydralazine hydrochloride is an orally active, blood-brain barrier-permeable DNA methyltransferase inhibitor with vasodilatory, arterial smooth muscle relaxant and hypotensive activities. Hydralazine hydrochloride reactivates silenced tumor suppressor genes via mediating DNA demethylation, while exerting neuroprotective and anti-inflammatory properties. Hydralazine hydrochloride inhibits NOS-2 (iNOS) and COX-2, and reduces the production of NO and PGEE2; meanwhile, Hydralazine hydrochloride scavenges reactive oxygen species and inhibits macrophage activation. Hydralazine hydrochloride alleviates motor dysfunction, neuropathic inflammatory pain, and formalin-induced somatic and emotional pain responses. In addition, Hydralazine hydrochloride directly induces DNA strand breaks and sister chromatid exchange, exhibiting certain mutagenic characteristics. Hydralazine hydrochloride has been widely used in studies on hypertension, various cancers (such as cervical cancer, leukemia), spinal cord injury and the mechanisms of inflammatory pain.
Isotope-Labeled Compounds   PGE synthase   NO Synthase   Reactive Oxygen Species (ROS)   DNA Methyltransferase   COX  
Blood or Cardio-cerebrovascular Disease  
/
HY-17034AS Dexmedetomidine-13C,d3 hydrochloride
Dexmedetomidine-13C,d3 (hydrochloride) is the 13C- and deuterium labeled Dexmedetomidine (hydrochloride). Dexmedetomidine hydrochloride ((+)-Medetomidine hydrochloride) is a potent, selective and orally active agonist of α2-adrenoceptor, with a Ki of 1.08 nM. Dexmedetomidine hydrochloride shows 1620-fold selectivity against α1-adrenoceptor. Dexmedetomidine hydrochloride exhibits anxiolysis, sedation, and modest analgesia effects.
Isotope-Labeled Compounds   Adrenergic Receptor  
Cancer   Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
/
HY-P5931 Spinoxin
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers.
Potassium Channel  
Cancer   Inflammation or Immune System Disease  
/
HY-N0488R Vincristine sulfate (Standard)
Vincristine (sulfate) (Standard) is the analytical standard of Vincristine (sulfate). This product is intended for research and analytical applications. Vincristine sulfate (Leurocristine; NSC-67574; 22-Oxovincaleukoblastine) is a microtubule inhibitor that disrupts microtubule polymerization by binding to β-tubulin (with a Ki of 85 nM in bovine), arrests the cell cycle and induces apoptosis. Vincristine sulfate inhibits cell replication, tumor blood flow and the proliferation of various cancer cells, while triggering effects such as oxidative stress, inflammation, calcium overload, epithelial-mesenchymal transition and peripheral neuropathic pain. Vincristine sulfate upregulates the expression of various transporters and nuclear receptors, and enriches gastric cancer stem-like cells. Vincristine sulfate is used in research related to various tumors including acute lymphoblastic leukemia, lymphoma, melanoma, gastric cancer, solid tumors and sarcomas.
Reference Standards   Apoptosis   Microtubule/Tubulin   Mitosis  
Cancer  
/
HY-N3915 Futoquinol
Futoquinol is a neolignan isolated from the dried aerial parts of Piper kadsura (Piperaceae). Futoquinol potently inhibits NO production in microglia cells. Futoquinol has anti-neuroinflammatory activities.
NO Synthase  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-B1901S Eperisone-d10 hydrochloride
Eperisone-d10 (hydrochloride) is the deuterium labeled Eperisone hydrochloride. Eperisone Hydrochloride ((±)-Eperisone hydrochloride) is an antispastic agent used for treatment of diseases characterized by muscle stiffness and pain. It works by relaxing both skeletal muscles and vascularsmooth muscles, thus demonstrating avariety of effects such as reduction ofmyotonia, improvement of circulationand suppression of the pain reflex. Eperisone Hydrochloride ((±)-Eperisone hydrochloride) is a centrally acting muscle relaxant inhibiting the pain reflex pathway, having a vasodilator effect[2 .
Isotope-Labeled Compounds  
Neurological, Eye or Ear Disease  
/
HY-N0488S Vincristine-d3 sulfate
Vincristine-d3 sulfate is the deuterium labeled Vincristine sulfate. Vincristine sulfate (Leurocristine; NSC-67574; 22-Oxovincaleukoblastine) is a microtubule inhibitor that disrupts microtubule polymerization by binding to β-tubulin (with a Ki of 85 nM in bovine), arrests the cell cycle and induces apoptosis. Vincristine sulfate inhibits cell replication, tumor blood flow and the proliferation of various cancer cells, while triggering effects such as oxidative stress, inflammation, calcium overload, epithelial-mesenchymal transition and peripheral neuropathic pain. Vincristine sulfate upregulates the expression of various transporters and nuclear receptors, and enriches gastric cancer stem-like cells. Vincristine sulfate is used in research related to various tumors including acute lymphoblastic leukemia, lymphoma, melanoma, gastric cancer, solid tumors and sarcomas.
Isotope-Labeled Compounds   Apoptosis   Microtubule/Tubulin   Mitosis  
Cancer  
/
HY-W018772S1 D-Ribose-13C
D-Ribose-13C is the 13C labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein glycati
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-B0464S1 Hydralazine-d5 hydrochloride
Hydralazine-d5 (hydrochloride) is deuterium-labeled Hydralazine (hydrochloride) (HY-B0464). Hydralazine hydrochloride is an orally active, blood-brain barrier-permeable DNA methyltransferase inhibitor with vasodilatory, arterial smooth muscle relaxant and hypotensive activities. Hydralazine hydrochloride reactivates silenced tumor suppressor genes via mediating DNA demethylation, while exerting neuroprotective and anti-inflammatory properties. Hydralazine hydrochloride inhibits NOS-2 (iNOS) and COX-2, and reduces the production of NO and PGEE2; meanwhile, Hydralazine hydrochloride scavenges reactive oxygen species and inhibits macrophage activation. Hydralazine hydrochloride alleviates motor dysfunction, neuropathic inflammatory pain, and formalin-induced somatic and emotional pain responses. In addition, Hydralazine hydrochloride directly induces DNA strand breaks and sister chromatid exchange, exhibiting certain mutagenic characteristics. Hydralazine hydrochloride has been widely used in studies on hypertension, various cancers (such as cervical cancer, leukemia), spinal cord injury and the mechanisms of inflammatory pain.
Isotope-Labeled Compounds   PGE synthase   NO Synthase   Reactive Oxygen Species (ROS)   DNA Methyltransferase   COX  
Cancer  
/
HY-P5014 Cortistatin-29 (human)
Cortistatin-29 (human) is a somatostatin neuropeptide with potential for studying diseases such as cancer, inflammation, autoimmunity, fibrosis, and pain.
Somatostatin Receptor  
Cancer   Inflammation or Immune System Disease  
/
HY-B1221S1 Flufenamic acid-13C6
Flufenamic acid-13C6 is the 13C6 labeled Flufenamic acid. Flufenamic acid is a non-steroidal anti-inflammatory agent, inhibits cyclooxygenase (COX), activates AMPK, and also modulates ion channels, blocking chloride channels and L-type Ca2+ channels, modulating non-selective cation channels (NSC), activating K+ channels. Flufenamic acid binds to the central pocket of TEAD2 YBD and inhibits both TEAD function and TEAD-YAP-dependent processes, such as cell migration and proliferation.
Isotope-Labeled Compounds   COX   AMPK   Potassium Channel   Chloride Channel   Calcium Channel   Parasite  
Inflammation or Immune System Disease  
/
HY-W110542H Poly(ethylene glycol) diacrylate (MW 10000)
Poly(ethylene glycol) diacrylate (PEGDA) (MW 10000) is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine. Poly(ethylene glycol) diacrylate (MW 10000) can be used to create a three-dimensional (3D) breast cancer cell culture model.
Biochemical Assay Reagents  
/
HY-P99382A Vopratelimab (Mouse IgG2a)
Vopratelimab (Mouse IgG2a) is a agonist monoclonal antibody that selectively targets Inducible CO-Stimulator of T cells (ICOS). The variable region of Vopratelimab (Mouse IgG2a) is consistent with that of Vopratelimab (HY-P99382), while the constant region is of Mouse IgG2a sequence. Vopratelimab (Mouse IgG2a) has antitumor immune response and enhances combinatorial efficacy with anti-PD-1 (HY-P9902A) therapy.

Species: Human

Others  
Cancer  
/
HY-N7069 4-Isopropylbenzyl alcohol
4-Isopropylbenzyl alcohol (Cuminic alcohol) is an opioid-dependent analgesic. 4-Isopropylbenzyl alcohol activates opioid receptor, regulates the L-Arginine (HY-N0455)/NO/cGMP pathway, and reduces spinal cord TNF-α and IL-1β levels; it binds to BSA (HY-D0842) via static quenching. 4-Isopropylbenzyl alcohol can be used in research related to nociceptive pain, neuropathic pain, bacterial infection and diabetes.
Opioid Receptor   TNF Receptor   Interleukin Related  
Bacterial Infection   Pain   Glucose Metabolism  
/
HY-P1198 Hemokinin 1, human
Hemokinin 1, human is a selective tachykinin neurokinin 1 (NK1) receptor full agonist. Hemokinin 1, human is a full agonist at NK2 and NK3 receptor. Hemokinin 1, human can produces an opioid-independent analgesia.
Neurokinin Receptor  
Neurological, Eye or Ear Disease  
/
HY-P99551 Tosatoxumab
Tosatoxumab (AR-301; KBSA301) is a human immunoglobulin G1 monoclonal antibody that specifically neutralizes alpha-toxin (alpha-hemolysin; Hla) of S. aureus. Tosatoxumab binds to an N-terminal epitope of alpha-toxin, thereby preventing functional toxin pore oligomerisation. Tosatoxumab has the potential for passive immunotherapy in the S. aureus pneumonia as an adjunctive therapy to standard antibiotic agent. Recommend Isotope Control: Human IgG1 lambda1, Isotype Control (HY-P99992).

Species: Human

Antibiotic   Bacterial  
Staphylococcus Aureus Infection  
/
HY-17447AG Tranylcypromine hydrochloride (GMP)
Tranylcypromine (SKF 385) hydrochloride (GMP) is Tranylcypromine hydrochloride (HY-17447A) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. Tranylcypromine hydrochloride is a potent monoamine oxidase (MAO) inhibitor.
Monoamine Oxidase  
Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
/
HY-76711S Naltrexone-d4
Naltrexone-d4 is deuterium labeled Naltrexone (HY-76711). Naltrexone is an orally active, long-acting opioid receptor (opioid receptor) antagonist. Naltrexone blocks the euphoric effects of exogenous opioids and reduces alcohol craving by blocking opioid receptors (μ, κ, and δ) as well as opioid growth factor receptors. Low doses of Naltrexone are used to relieve chronic pain, treat inflammatory diseases and inhibit tumor growth, while high doses or continuous administration exert pro-inflammatory or pro-proliferative effects. Naltrexone relieves intractable pruritus caused by psoriasis, atopic dermatitis and other conditions, and its combination with Bupropion (HY-B0403) inhibits food craving, thereby reducing body weight.
Isotope-Labeled Compounds   Opioid Receptor  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-N2439 Methyl isoeugenol
Methyl isoeugenol is an orally active, blood-brain barrier-permeable isoeugenol-type eugenol analog. Methyl isoeugenol promotes the nuclear translocation of Nrf2, upregulates the expressions of HO-1, NQO1 and SOD, and reduces the expression level of MDA. Methyl isoeugenol decreases the nuclear translocation of NF-κB. Methyl isoeugenol inhibits NLRP3 inflammasome-mediated pyroptosis. Methyl isoeugenol reduces cerebral infarction volume and regulates the M1/M2 phenotypic balance of microglia. Methyl isoeugenol can be used for the research of cerebral ischemia-reperfusion injury.
Environmental Pollutants   Quinone Reductase   SOD   NF-κB   Pyroptosis   Keap1-Nrf2  
Blood or Cardio-cerebrovascular Disease  
/
HY-B0402S Amantadine-d15
Amantadine-d15 is the deuterium labeled Amantadine. Amantadine (1-Adamantanamine) is an antiviral agent with activity against influenza A viruses. Amantadine blocks the proton flow through the M2 ion channel (M2 proton channel of influenza A) and thus prevents the release of viral RNA into the cytoplasm of the infected cells. Amantadine is an antiparkinsonian agent.
Influenza Virus   Orthopoxvirus   SARS-CoV   Apoptosis  
Cancer   Infection   Neurological, Eye or Ear Disease  
/
HY-P1346A APETx2 TFA
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.
Sodium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P1091 Hemopressin (human, mouse)
Hemopressin is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin exerts antinociceptive action in inflammatory pain models.
Cannabinoid Receptor  
Neurological, Eye or Ear Disease  
/
HY-B0246S4 Carbamazepine-d4
Carbamazepine-d4 (CBZ-d4) is the deuterium labeled Carbamazepine (HY-B0246). Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC50 of 131 μM. Carbamazepine blocks voltage gated Na+, Ca2+, and K+ channels, and is also a HDAC inhibitor (IC50: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain.
Isotope-Labeled Compounds  
/
HY-N2338 Cholesterol myristate
Cholesterol myristate is a natural steroid present in traditional Chinese medicine. Cholesterol myristate binds to several ion channels such as the nicotinic acetylcholine receptor, GABAA receptor, and the inward-rectifier potassium ion channel.
nAChR   GABA Receptor   Potassium Channel   Endogenous Metabolite  
Cancer   Alzheimer's Disease   Parkinson's Disease  
/
HY-P11315 MG1 peptide
MG1 peptide is an M1 microglia-targeting peptide with blood-brain barrier permeability. MG1 peptide can be used in studies related to ischemic stroke and cerebral ischemia-reperfusion injury.
Biochemical Assay Reagents  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-W040430 (S)-Nornicotine
(S)-Nornicotine is a nicotine metabolite that crosses the blood-brain barrier. (S)-Nornicotine weakly inhibits human CYP2A6 with a Ki >300 μM. (S)-Nornicotine promotes dopamine release in rat striatal and nucleus accumbens slices and increases endogenous DOPAC overflow through a calcium-dependent nAChR pathway that is sensitive to Mecamylamine (HY-B1395A). (S)-Nornicotine reduces behavioral responses maintained by nicotine or sucrose, exerts analgesic effects in persistent inflammatory pain and neuropathic pain models, and enhances the analgesic effect of morphine. (S)-Nornicotine is useful for research on tobacco dependence and pain.
Drug Metabolite   Cytochrome P450   nAChR  
Pain  
/
HY-114146 CID 1375606
CID 1375606 is a surrogate agonist of orphan G protein-coupled receptor GPR27.
Orphan GPCR  
Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
/
HY-W357818 Glycinexylidide
Glycinexylidide (GX) is the active metabolite of Lidocaine. Lidocaine is a local agent that can suppress or relieve pain, that inhibits sodium channels involving complex voltage and dependence. Lidocaine also reduces the growth, migration and invasion of gastric cancer cells. Glycinexylidide has research potential for use in anesthesia, cancer, and cardiovascular disease.
Sodium Channel   NF-κB   MEK   ERK   Drug Metabolite  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   Obesity   Rheumatoid Arthritis  
/
HY-W110542O Poly(ethylene glycol) diacrylate (MW 575),MEHQ as inhibitor
Poly(ethylene glycol) diacrylate (PEGDA) (MW 575), MEHQ as inhibitor is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine. Poly(ethylene glycol) diacrylate (MW 575), MEHQ as inhibitor can be used for the synthesis of a class of biodegradable polymers.
Biochemical Assay Reagents  
/
HY-P99200 Fulranumab
Fulranumab is a human IgG2 monoclonal antibody against nerve growth factor (NGF) and can be used for the research of pain.

Species: Human

Trk Receptor  
Neurological, Eye or Ear Disease  
/
HY-D0957 Ethyl Violet
Ethyl Violet is a triphenylmethane cationic dye with antibacterial activity. Ethyl Violet is applicable to research related to antibacterial therapy and histological staining.
Fluorescent Dye   Bacterial  
Staphylococcus Aureus Infection  
/
HY-P99627 Frunevetmab
Frunevetmab (NV-02) is a felinized anti-nerve growth factor (NGF) monoclonal antibody with a Kd of 20 pM. Frunevetmab can effectively decrease osteoarthritis (OA) pain in cats.

Species: Felcat

Trk Receptor  
Inflammation or Immune System Disease  
/
HY-B0476S Phenacetin-d5
Phenacetin-d5 is the deuterium labeled Phenacetin. Phenacetin (Acetophenetidin) is a non-opioid analgesic/antipyretic agent. Phenacetin is a selective COX-3 inhibitor. Phenacetin is used as probe of cytochrome P450 enzymes CYP1A2 in human liver microsomes and in rats.
COX  
Inflammation or Immune System Disease  
/
HY-A0057S Gabapentin-d4
Gabapentin-d4 is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.
Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-B0405S Bupivacaine-d9
Bupivacaine-d99 is a deuterium labeled Bupivacaine. Bupivacaine is a NMDA receptor inhibitor.Bupivacaine can block sodium, L-calcium, and potassium channels.Bupivacaine potently blocks SCN5A channels with the IC50 of 69.5 μM. Bupivacaine can be used for the research of chronic pain.
Isotope-Labeled Compounds   iGluR   Sodium Channel   Calcium Channel   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-W110542D Poly(ethylene glycol) diacrylate (MW 1000)
Poly(ethylene glycol) diacrylate (PEGDA) (MW 1000) is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine.
Biochemical Assay Reagents  
/
HY-W018772S12 D-Ribose-d6
D-Ribose-d6 is the deuterium labeled D-Ribose. D-Ribose is an energy enhancer, and acts as a sugar moiety of ATP, and widely used as a metabolic therapy supplement for chronic fatigue syndrome or cardiac energy metabolism. D-Ribose is active in protein gl
Isotope-Labeled Compounds   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
/
HY-N7144A Citronellyl acetate
Citronellyl acetate, a monoterpene product of the secondary metabolism of plants, is an orally active antinociceptive agent. Citronellyl acetate modulates TRPV1, TRPM8, ASIC, glutamate receptors, PKC, and PKA-mediated nociception. Citronellyl acetate can be used for the research of acute pain.
Environmental Pollutants   PKA   TRP Channel   PKC  
Neurological, Eye or Ear Disease  
/
HY-N1847 3'-Methoxydaidzein
3'-Methoxydaidzein is a isoflavone and a Sodium Channel inhibitor. 3'-Methoxydaidzein inhibits subtypes NaV1.7, NaV1.8 and NaV1.3 with IC50 of 181 nM, 397 nM, and 505 nM, respectively. 3'-Methoxydaidzein exerts analgesic activity by inhibiting voltage-gated sodium channels.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-15147G XAV-939 (GMP)
XAV-939 (GMP) is XAV-939 (HY-15347) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. XAV-939 is a tankyrase inhibitor.
PARP  
Cancer   Neurological, Eye or Ear Disease  
/
HY-DY1081 DAPI dihydrochloride (solution)
DAPI (4',6-Diamidino-2-phenylindole) dihydrochloride (solution) is a DAPI dye. DAPI is a fluorescent dye that binds strongly to DNA. It binds to the AT base pair of the double-stranded DNA minor groove, and one DAPI molecule can occupy three base pair positions. The fluorescence intensity of DAPI molecules bound to double-stranded DNA is increased by about 20 times, and it is commonly observed with fluorescence microscopy, and the amount of DNA can be determined based on the intensity of fluorescence. DAPI cannot penetrate intact cell membranes and is commonly used for staining damaged and fixed cells. DAPI (Compound 3) is an acid-sensing ion channel 3 (ASIC3) inhibitor. DAPI binds to ASIC3 and blocks the channel function. DAPI can be used in the study of chronic pain treatment (Ex/Em = 356/451 nm).
Solvent and concentration: ddH2O: 5 mg/mL
Sodium Channel   DNA Stain  
/
HY-W010448 Imidazol-1-yl-acetic acid
Imidazol-1-yl-acetic acid is a BRS-3 agonist that mediates anorectic effects through activation of orphan G protein-coupled receptors (Orphan GPCR) in peripheral tissues; it also serves as a green, water-soluble, recyclable bifunctional organocatalyst for transformations such as Biginelli multicomponent reactions and epoxide ring opening. Imidazol-1-yl-acetic acid is used in the study of obesity.
Bombesin Receptor   Orphan GPCR  
Obesity  
/
HY-W008951 Ethylenediaminetetra(methylenephosphonic acid)
Ethylenediaminetetramethylenephosphonic acid (EDTMP) is a bone-targeted chelating agent. Ethylenediaminetetramethylenephosphonic acid sodium‘s phosphonic acid groups possess a unique ability to bind with high affinity to hydroxyapatite in bone, and can form radioactive compounds with 153Sm and 177Lu. Ethylenediaminetetramethylenephosphonic acid is used to study palliative therapy for pain associated with multiple bone metastatic cancers.
Radionuclide-Drug Conjugates (RDCs)  
Pain   Multiple Myeloma  
/
HY-P5121A γ-Fibrinogen 377-395 TFA
γ-Fibrinogen377-395 TFA is a fibrinogen-derived inhibitory peptide, as well as fibrinogen epitope. γ-Fibrinogen377-395 TFA blocks microglia activation and inhibits fibrin-Mac-1 interactions in vitro, and suppresses experimental autoimmune encephalomyelitis (EAE) in mice in vivo. γ-Fibrinogen377-395 TFA can be used for research in multiple sclerosis (MS), and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Others  
Blood or Cardio-cerebrovascular Disease  
/
HY-B0563S1 Ropivacaine-d7
Ropivacaine-d7 is deuterium labeled Ropivacaine. Ropivacain is a potent?sodium channel?blocker. Ropivacain blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is used for the research of neuropathic pain?management.
Isotope-Labeled Compounds   Sodium Channel   Potassium Channel  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-N7126 Citronellal
Citronellal is a monoterpene that can be found in the essential oils in various aromatic species of plants, with antiinflammatory and antinociceptive properties. Citronellal attenuates mechanical nociception, mediated in part by the NO-cGMP-ATP-sensitive K+ channel pathway. Citronellal induces reduction of spontaneuous activity, ataxia, analgesia, and sedation in vivo. Citronellal can attenuate mechanical nociception response in mouse model.
Environmental Pollutants   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-N5025 Bullatine A
Bullatine A, a diterpenoid alkaloid, is a potent P2X7 antagonist. Bullatine A possesses anti-rheumatic, anti-inflammatory and anti-nociceptive effects. Bullatine A inhibits ATP-induced BV-2 cell death/apoptosis and P2X receptor-mediated inflammatory responses. Bullatine A suppresses glioma cell growth by targeting SIRT6. Bullatine A specifically attenuates pain hypersensitivity in rats. Bullatine A attenuates LPS (HY-D1056)-induced systemic inflammatory response by inhibiting the ROS/JNK/NF-κB pathway in mice. Bullatine A improves despair behavior in Chronic chronic social defeat stress (CSDS) mice. Bullatine A can be used for the study of inflammation, glioblastoma (GBM) and depression.
P2X Receptor   Apoptosis   ERK   p38 MAPK   c-Myc   NF-κB   Reactive Oxygen Species (ROS)  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Neurodegenerative Disease   Depression   Pain   Digestive System Inflammation   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
/
HY-B2156R Menaquinone-4 (Standard)
Menaquinone-4 (Standard) is the analytical standard of Menaquinone-4. This product is intended for research and analytical applications. Menaquinone-4 is a vitamin K, used as a hemostatic agent, and also a adjunctive therapy for the pain of osteoporosis.
Reference Standards   Endogenous Metabolite  
Cancer  
/
HY-N0688 Linderane
Linderane is an orally active natural sesquiterpene lactone with blood-brain barrier permeability. Linderane indirectly activates PDE3 by activating ERK/STAT3, thereby inhibiting the cAMP/PKA/CREB signaling pathway and hepatic gluconeogenesis. Linderane protects pancreatic β cells against oxidative damage by inhibiting the activation of the p38 MAPK pathway and activating the Nrf2 pathway. Linderane inhibits cell apoptosis and ameliorates intestinal mucosal inflammation by suppressing the IL-6/JAK/STAT3 signaling pathway. Linderane reduces pain sensitivity and alleviates anxiety-like behaviors by activating cannabinoid receptor 2 (CB2R). Linderane can be used in studies related to type 2 diabetes, ulcerative colitis, and chronic inflammatory pain with anxiety.
ERK   STAT   Phosphodiesterase (PDE)   PKA   p38 MAPK   Keap1-Nrf2   JAK   Interleukin Related   Apoptosis   Cannabinoid Receptor  
Pain   Type 2 Diabetes   Ulcerative Colitis  
/
HY-W110542N Poly(ethylene glycol) diacrylate (MW 250),MEHQ as inhibitor
Poly(ethylene glycol) diacrylate (PEGDA) (MW 250), MEHQ as inhibitor is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine. Poly(ethylene glycol) diacrylate (MW 250), MEHQ as inhibitor can be used to construct optical cross-linked hydrogel implants.
Biochemical Assay Reagents  
/
HY-W110542J Poly(ethylene glycol) diacrylate (MW 700)
Poly(ethylene glycol) diacrylate (PEGDA) (MW 700) is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine. Poly(ethylene glycol) diacrylate (MW 700) mimics the extracellular matrix (ECM), providing support and growth space for cells.
Biochemical Assay Reagents  
/
HY-163087 PT-91
PT-91 is an agonist of GPR27. PT-91 exhibits high metabolic stability and brain exposure in mice.
Orphan GPCR  
Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
/
HY-P5011 Cortistatin-17 (human)
Cortistatin-17 (human) is a somatostatin neuropeptide with potential for studying diseases such as cancer, inflammation, autoimmunity, fibrosis, and pain.
Somatostatin Receptor  
Cancer   Inflammation or Immune System Disease  
/
HY-W110542P Poly(ethylene glycol) diacrylate (MW 4000), MEHQ as inhibitor
Poly(ethylene glycol) diacrylate (PEGDA) (MW 4000), MEHQ as inhibitor is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine. Poly(ethylene glycol) diacrylate (MW 4000), MEHQ as inhibitor can be used to construct enzyme-responsive hydrogel drug delivery system.
Biochemical Assay Reagents  
/
HY-N0637A (±)-Eriodictyol
(±)-Eriodictyol ((±)-Huazhongilexone; Dihydroluteolin) is an orally active TRPV1 receptor antagonist (IC50=44-47 nM, rTRPV1) with antioxidant and anti-inflammatory activities. (±)-Eriodictyol effectively inhibits lipid peroxidation and the release of proinflammatory cytokines by specifically antagonizing the TRPV1 receptor and activating the Nrf2 signaling pathway. (±)-Eriodictyol reduces the levels of ICAM-1, VEGF, eNOS and TNF-α in the retina and maintains the integrity of the blood-retinal barrier. (±)-Eriodictyol alleviates oxidative stress-induced apoptosis and hyperalgesia, enhances the activity and cytotoxicity of immune cells (such as B lymphocytes, NK cells and macrophages), and increases the levels of antioxidant enzymes simultaneously. (±)-Eriodictyol can be used in the research of diabetic retinopathy, acute lung injury and various pain-related diseases.
Melanocortin Receptor   TRP Channel  
Metabolic or Endocrine Disease  
/
HY-156354 GPR61 Inverse agonist 1
GPR61 Inverse agonist 1 (Compound 1) is a GPR61 inverse agonist (IC50: 11 nM). GPR61 Inverse agonist 1 can be used for research of disorders of metabolism and body weight, such as obesity and cachexia.
Orphan GPCR  
Metabolic or Endocrine Disease  
/
HY-155417 GPR34 receptor antagonist 3
GPR34 receptor antagonist 3 (Compound 5e) is a class of GRP34 antagonists, IC50 is 0.680 μM. GPR34 receptor antagonist 3 inhibited ERK1/2 phosphorylation induced by lysophosphatidylserine in a dose-dependent way without obvious cytotoxicity. GPR34 receptor antagonist 3 shows antisensory activity in mouse neuropathic pain model .
Orphan GPCR   ERK  
Colorectal Cancer   Prostate Cancer   Liver Cancer   Pain   Obesity  
/
HY-D0142 Pyrene-1,3,6,8-tetrasulfonic acid tetrasodium
Pyrene-1,3,6,8-tetrasulfonic acid tetrasodium is a fluorescent dye and pH indicator, also as a ligand of multifunctional metal-organic framework. Pyrene-1,3,6,8-tetrasulfonic acid tetrasodium has been used to detect CO2 release. Pyrene-1,3,6,8-tetrasulfonic acid tetrasodium acts as a water-soluble fluorescent dye for fluorescence quenching assays monitoring gramicidin ion-channel activity. Ex/Em = 396/404 nm.
Fluorescent Dye  
/
HY-W001992 2,6-Dichloro-3-nitropyridine
2,6-Dichloro-3-nitropyridine is a starting compound for the synthesis of a sulfide analog of Flupirtine (HY-17001A) with KV7.2/3 channel opening activity. 2,6-Dichloro-3-nitropyridine can be used in pain research.
Biochemical Assay Reagents  
Neurological, Eye or Ear Disease  
/
HY-P3538 Corticotropin-releasing factor (Sheep)
Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor activity. Corticotropin-releasing factor (Sheep) can be used for the research of neurological disease.
Others  
Neurological, Eye or Ear Disease  
/
HY-N0388 Gelsemine
Gelsemine, an alkaloid from the Chinese herb Gelsemium elegans, is effective in mitigating chronic pain. Antinociceptive effects.
Others  
Neurological, Eye or Ear Disease  
/
HY-N3945 Glaucine
Glaucine (O,O-Dimethylisoboldine) is an alkaloid extracted from Glaucium flavum that possesses various activities, including cough relief, bronchodilation, anti-inflammatory effects, analgesia, antipyretic properties, and anticancer effects. Glaucine acts as a selective and orally active inhibitor of phosphodiesterase 4 (PDE4), with a Ki of 3.4 µM in human bronchial tissues and polymorphonuclear leukocytes. Glaucine induces relaxation of human isolated bronchi by antagonizing calcium channels. Additionally, Glaucine inhibits the activation of NF-κB, leading to a reduction in the expression of the MMP-9 gene, thereby suppressing the migration and invasion of breast cancer cells. Therefore, Glaucine holds potential for research in asthma and breast cancer.
Phosphodiesterase (PDE)   Calcium Channel   MMP   NF-κB  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   Alzheimer's Disease   Hypertension   Obesity   Lung Fibrosis  
/
HY-13257G Thiazovivin (GMP)
Thiazovivin (GMP) is Thiazovivin (HY-13257) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. Thiazovivin is a potent ROCK inhibitor.
ROCK  
Cancer  
/
HY-155318A GPR3 agonist-2
GPR3 agonist-2(compound 32) is a potent full agonist of G protein-coupled receptor 3, with the IC50of 260 nM.
Orphan GPCR  
Metabolic or Endocrine Disease  
/
HY-N0140R Ursolic acid (Standard)
Ursolic acid (Standard) is the analytical standard of Ursolic acid. This product is intended for research and analytical applications. Ursolic acid (Prunol) is a natural pentacyclic triterpenoid carboxylic acid, exerts anti-tumor effects and is an effective compound for cancer prevention and therapy.
Reference Standards   Autophagy   Endogenous Metabolite  
Cancer  
/
HY-P990059 Puxitatug
Puxitatug (INT-016; AZD8205 Antibody) is a monoclonal antibody targeting VTCN1/B7-H4. Puxitatug can be used to synthesize antibody-drug conjugates (ADCs), such as Puxitatug samrotecan (HY-171689), which can be applied to various solid tumors. Puxitatug can also be used for researching adjuvant therapies for gastric cancer.

Species: Human

ADC Antibodies   CD276/B7-H3  
Cancer  
/
HY-13027G DAPT (GMP)
DAPT (GSI-IX) (GMP) is DAPT (HY-13027) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. DAPT is a potent and orally active γ-secretase inhibitor.
γ-secretase  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P5762 Phoenixin-14
Phoenixin-14 (PNX-14) is one of the endogenous active isoform, and generates anxiolytic effect via the activation of the AHA GnRH system in mice. Phoenixin-14 inhibits ischemia/reperfusion-induced cytotoxicity in microglia.
GnRH Receptor  
Neurological, Eye or Ear Disease  
/
HY-129763 Di-4-ANEPPS
Di-4-ANEPPS is a voltage-sensitive dye that acts on voltage-gated ion channels (such as sodium channels) and inhibits sodium current, significantly reducing sodium current density, although specific values like IC50 remain unclear. It mainly binds to the voltage-sensitive regions on the cell membrane, changing its fluorescence properties to reflect membrane potential changes and thus affecting the function of ion channels to exert its activity. This substance can be used in cardiovascular research, such as the electrophysiology of cardiomyocytes, myocardial ischemia, and the effects of drugs on cardiomyocytes. It is of great value in evaluating drug cardiotoxicity and exploring the mechanisms of arrhythmias.
Fluorescent Dye  
Blood or Cardio-cerebrovascular Disease  
/
HY-129724A α-MSH (11-13) acetate
α-MSH (11-13) (ACTH-(11-13)) acetate is a C-terminal tripeptide of α-MSH that can cross the blood-brain barrier. α-MSH (11-13) acetate exhibits antipyretic, anti-inflammatory, and antibacterial activities. α-MSH (11-13) acetate also exerts neuroprotective effects after traumatic brain injury by inhibiting excessive activation of microglia and reducing neuronal apoptosis. α-MSH (11-13) acetate can be used in research related to traumatic brain injury, fever, and bacterial infections.
Melanocortin Receptor   Interleukin Related   Bacterial   NF-κB   Apoptosis  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P1160 Bay 55-9837
Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.
GCGR  
Metabolic or Endocrine Disease  
/
HY-N15721 Tryptophan-cholic acid
Tryptophan-cholic acid (Trp-CA) is a microbial amino acid-conjugated bile acid that acts as an endogenous ligand and agonist (EC50=9.6 μM) for the orphan G protein-coupled receptor (GPCR) MRGPRE (Mas-related G protein-coupled receptor family member E). Tryptophan-cholic acid is orally effective but has poor oral absorption and does not cross the blood-brain barrier. Tryptophan-cholic acid promotes the secretion of glucagon-like peptide GLP-1, thereby improving glucose tolerance in diabetic mice. Tryptophan-cholic acid improves glucose tolerance, promotes insulin secretion, and alleviates high-fat diet-induced hepatic steatosis without causing pruritus side effects. Tryptophan-cholic acid is primarily used in research on type 2 diabetes (T2D).
Orphan GPCR   GLP Receptor  
Type 2 Diabetes  
/
HY-P5911 GluN1(359-378)
GluN1 (359-378) is an anti-N-methyl-D-aspartate receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier. GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting the immune system.
iGluR  
Inflammation or Immune System Disease  
/
HY-W110542G Poly(ethylene glycol) diacrylate (MW 6000)
Poly(ethylene glycol) diacrylate (PEGDA) (MW 6000) is a versatile polymer material that is widely used as a building material for hydrogel scaffolds, especially in the fields of tissue engineering and regenerative medicine. Poly(ethylene glycol) diacrylate (MW 6000) can be used as a building material for wound dressing hydrogels.
Biochemical Assay Reagents  
/
HY-19204 Zinc phthalocyanine
Zinc phthalocyanine (ZnPc) is commonly applied in industry (catalysts, photoconductors) and biomedical (photodynamic therapy, PDT). Zinc phthalocyanine can be used to photooxidise cyclohexane and is promising for research of solar-cell applications.
Ligands for Target Protein for PROTAC   Reactive Oxygen Species (ROS)   Apoptosis   Caspase  
Cancer  
/
HY-156815 YL-365
YL-365 is a potent and selective GPR34 antagonist with an IC50 of 17 nM. YL-365 binds to a portion of the orthosteric binding pocket of GPR34 and induces allosteric changes that stabilize the receptor in an inactive conformation. YL-365 down-regulates expression of the proinflammatory gene iNOS in M1 microglia and suppresses proinflammatory responses. YL-365 reduces mechanical allodynia in a dose-dependent manner in a mouse model of neuropathic pain. YL-365 can be used for the research of neuropathic pain.
Orphan GPCR  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-NP0204 MSA Protein
MSA Protein (Mouse Serum Albumin) is most abundant protein in plasma, which leaks into the brain parenchyma when the blood-brain barrier (BBB) is impaired. Mouse Serum Albumin induces astrocytes to A1 phenotype to remarkably increase levels of Elovl1. Mouse Serum Albumin promotes VLSFAs secretion and causes neuronal lippoapoptosis through endoplasmic reticulum stress response pathway. MSA-activated microglia triggeres remarkable tau phosphorylation at multiple sites (Ser202/Thr205) through NLRP3 inflammasome pathway. Mouse Serum Albumin decreases the spatial learning and memory abilities in mice. Mouse Serum Albumin can be used for the study of neurodegenerative diseases like Alzheimer’s disease (AD) and frontotemporal dementia (FTD).
ELOVL   Apoptosis   NOD-like Receptor (NLR)   Caspase   Tau Protein  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-Y0319G Magnesium acetate tetrahydrate
Magnesium acetate tetrahydrate is a carboxylic acid and short-chain fatty acid (SCFAs). Magnesium acetate tetrahydrate activates AMPK, increases ROS, cleaved caspase 9, PPARα, downregulates SREBP-1c, ChREBP expression. Magnesium acetate tetrahydrate exhibits antifungal activity against Saccharomyces cerevisiae W303-1A. Magnesium acetate tetrahydrate regulates energy metabolism. Magnesium acetate tetrahydrate has anticancer activity against gastric cancer. Magnesium acetate tetrahydrate induces writhing reaction and ulcerative colitis. Magnesium acetate tetrahydrate can be used in the researches for gastric cancer, ulcerative colitis, hepatic steatosis, and pain.
Endogenous Metabolite   AMPK   Reactive Oxygen Species (ROS)   Caspase   Fungal   PPAR  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-N0042 Ginsenoside Rc
Ginsenoside Rc, one of major Ginsenosides from Panax ginseng, enhances GABA receptorA (GABAA)-mediated ion channel currents (IGABA). Ginsenoside Rc inhibits the expression of TNF-α and IL-1β.
GABA Receptor   TNF Receptor   Interleukin Related  
Digestive System Disease   Prostate Cancer   Depression   Pain   Digestive System Inflammation   Alzheimer's Disease   Parkinson's Disease   Lung Fibrosis   Rheumatoid Arthritis  
/
HY-P990043 Iluzanebart
Iluzanebart is a human monoclonal IgG1 antibody and is the agonist antibody for human TREM2 (hTREM2). Iluzanebart improves the survival and function of microglia by activating the TREM2 signaling pathway to compensate for the loss of CSF1R function. Iluzanebart can be used for research of adult-onset leukoencephalopathy associated with CSF1R (colony stimulating factor 1 receptor) (CSF1R-ALSP).

Species: Human

Ser/Thr Kinase   TREM receptor  
Inflammation or Immune System Disease  
/
HY-P991220 AL002
AL002 is a humanized monoclonal IgG1 antibody and a blood-brain barrier-permeable TREM2 modulator. AL002 binds to TREM2 on the surface of microglia, promotes TREM2 clustering and the formation of the TREM2-DAP12 complex, activates the TREM2 signaling pathway and PI3K cascade, and induces TREM2 internalization and degradation. AL002 is applicable to research related to Alzheimer's disease.

Species: Human

TREM receptor  
Alzheimer's Disease  
/
HY-110252 Salvinorin B
Salvinorin B is a selective and brain-penetrant kappa opioid receptor (KOPr) agonist with an EC50 of 248 nM and Ki of 2.95 μM. Salvinorin B activates downstream signaling pathways by binding to KOPr, inhibits pain transmission and reduces inflammatory response. Salvinorin B can be used for the researches of inflammation, immunology and neurological disease, such as neuropathic pain, multiple sclerosis and anxiety.
Opioid Receptor  
Inflammation or Immune System Disease   Depression   Pain  
/
HY-Y1325I Sodium acetate trihydrate, 99.5%
Sodium acetate trihydrate, 99.5% is a carboxylic acid and short-chain fatty acid (SCFAs). Sodium acetate trihydrate activates AMPK, increases ROS, cleaved caspase 9, PPARα, downregulates SREBP-1c, ChREBP expression. Sodium acetate trihydrate exhibits antifungal activity against Saccharomyces cerevisiae W303-1A. Sodium acetate trihydrate regulates energy metabolism. Sodium acetate trihydrate has anticancer activity against gastric cancer. Sodium acetate trihydrate induces writhing reaction and ulcerative colitis. Sodium acetate trihydrate can be used in the researches for gastric cancer, ulcerative colitis, hepatic steatosis, and pain.
Fungal   PPAR   Caspase   Reactive Oxygen Species (ROS)   Endogenous Metabolite   AMPK  
Gastric Cancer   Pain   Liver Disease   Colitis  
/
HY-P811555 AIF1 Antibody (YA10103)
AIF1 Antibody (YA10103) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to AIF1.

Host: Rabbit; Reactivity: Human, Mouse, Rat

Monoclonal Antibodies Recombinant Antibodies Primary Antibodies

/
HY-P86921 Iba1 Antibody(YA6614)
Iba1 Antibody(YA6614) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to Iba1.

Host: Rabbit; Reactivity: Mouse

Monoclonal Antibodies Recombinant Antibodies Primary Antibodies

/
HY-P86536 Iba1 Antibody (YA6228)
Iba1 Antibody (YA6228) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to Iba1.

Host: Rabbit; Reactivity: Human, Mouse, Rat

Monoclonal Antibodies Recombinant Antibodies Primary Antibodies

/

Keywords

pain management | non-addictive therapies | nonopioid analgesics | chronic pain | acute pain | neuropathic pain | inflammatory pain | nociplastic pain | nociceptors | NaV1.8 | suzetrigine | ion channels | neuroimmune signaling | microglia | regenerative medicine | neuromodulation | precision analgesia