Topics

CCL2/CCR2 in Peripheral Pain Sensitization

Chronic Inflammation Intercellular Communication & Diseases Calcium Homeostasis Cellular Stress

CCL2, also known as monocyte chemoattractant protein-1, and its receptor CCR2 form a chemokine signaling axis increasingly recognized as a regulator of peripheral pain sensitization. Early work in neuropathic pain models established that peripheral nerve injury upregulates CCL2 and CCR2 in dorsal root ganglion (DRG) neurons, including TRPV1-expressing nociceptors, and that CCL2 increases nociceptor excitability. Neuronal CCL2 is packaged in large dense-core vesicles and can undergo calcium-dependent release after depolarization, supporting a neuromodulatory function within sensory ganglia. Subsequent studies linked this axis more directly to ion-channel remodeling: CCL2 increases Nav1.8 current density through CCR2 and Gβγ released from pertussis-toxin-sensitive Gi/o proteins, while longer CCL2 exposure increases both TRPV1 and Nav1.8 function and expression through PI3K/Akt signaling. These findings position CCL2/CCR2 at an intersection between neuroinflammation, chemokine signaling, sensory-neuron excitability, and peripheral hyperalgesia rather than restricting its function to immune-cell chemotaxis. Experimental inflammatory pain studies further define how this pathway converts peripheral inflammation into persistent nociceptor sensitization[1][2][3].

CFA-induced inflammation increases CCL2/CCR2 and substance P expression in ipsilateral DRGs and increases CCL2 release; CCL2 stimulation subsequently produces a CCR2-dependent increase in intracellular calcium mobilization and neuronal excitability. CCR2 blockade with INCB3344 limits calcium mobilization, reduces peripheral substance P transport, decreases neurogenic inflammation, and attenuates stimulus- and movement-evoked nociceptive behaviors. The pathway also extends beyond conventional inflammatory models. Paclitaxel-induced peripheral neuropathy is accompanied by induction of CCL2 and CCR2 in primary sensory neurons, and local interference with this signaling attenuates mechanical hypersensitivity and intraepidermal nerve-fiber loss. Thus, CCL2/CCR2 has become a drug-discovery target across inflammatory pain, neuropathic pain, chemotherapy-induced peripheral neuropathy, and conditions involving persistent DRG neuroimmune signaling. Together, these models identify neuronal CCR2 and its downstream control of calcium signaling, TRPV1, Nav1.8, neuropeptide trafficking, and sensory-neuron excitability as experimentally tractable mechanisms of peripheral pain sensitization[2][3][4][5].

Translation remains the central unresolved challenge. Although inhibition of CCL2/CCR2 signaling relieves inflammatory and neuropathic pain in rodent models, clinical trials targeting CCR2 in inflammatory conditions and painful neuropathies have failed to meet efficacy expectations and were discontinued, indicating a substantial gap between preclinical pathway validation and clinical analgesia. Recent work therefore explored intracellular, cell-penetrating allosteric modulation rather than conventional CCR2 antagonism. The CCR2-selective pepducin PP101 reduced neuropathic and bone cancer pain in preclinical models; in bone metastasis, it acted on CCR2-expressing DRG neurons, reduced sensory-neuron alterations and the DRG neuroinflammatory environment, and blocked CD4+ and CD8+ T-cell infiltration. These observations make target selectivity, cellular site of action, neuroimmune interactions, and disease-specific mechanisms important directions for future CCL2/CCR2 research. Determining which pain states depend most strongly on peripheral neuronal CCR2, and whether more selective modulation can overcome previous translational limitations, will be essential before the pathway can support clinically effective non-opioid analgesic strategies.[4][6].

Articles

All
  • All
  • Scientific Reviews
  • EDM
  • Blog
Most Recent
  • Most Recent
  • Oldest

Products

All
  • All
  • Inhibitors & Agonists
  • Isotope-Labeled Compounds
  • Fluorescent Dye
  • Peptides
  • Recombinant Proteins
  • Antibodies
  • Screening Libraries
  • Inhibitory Antibodies
  • Reference Standards
  • Induced Disease Models Products
  • GMP Small Molecules
  • Biochemical Assay Reagents
  • Natural Products
Cat. No. Product Name Information Application Publication
HY-19312 3-Methyladenine
3-Methyladenine (3-MA) is a PI3K inhibitor. 3-Methyladenine is a widely used inhibitor of autophagy via its inhibitory effect on class III PI3K.
PI3K   Autophagy   Mitophagy   Endogenous Metabolite  
Cancer  
1349
HY-10108 LY294002
LY294002 is a broad-spectrum inhibitor of PI3K with IC50s of 0.5, 0.57, and 0.97 μM for PI3Kα, PI3Kδ and PI3Kβ, respectively. LY294002 also inhibits CK2 with an IC50 of 98 nM. LY294002 is a competitive DNA-PK inhibitor that binds reversibly to the kinase domain of DNA-PK with an IC50 of 1.4 μM. LY294002 is an apoptosis activator.
PI3K   Casein Kinase   DNA-PK   Apoptosis   Autophagy  
Infection   Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Pain   Digestive System Inflammation   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
1221
HY-10071 Y-27632
Y-27632 is a ROCK inhibitor with Ki values of 220 nM and 300 nM for ROCK1 and ROCK2, respectively. Y-27632 exerts anti-inflammatory and immunomodulatory effects in systemic lupus erythematosus models by inhibiting the ROCK/NF-κB pathway. Y-27632 enhances autophagy by inhibiting the AKT/mTOR pathway, thereby inducing apoptosis apoptosis in oral squamous cell carcinoma. Y-27632 induces the formation of tunneling nanotubes in ARPE-19 cells and significantly enhances mitochondrial transfer through these channels. Y-27632 promotes neurite outgrowth in PC12 cells by activating the Rac1/NOX1/ROS/AKT/PAK1 signaling cascade.
ROCK   Reactive Oxygen Species (ROS)   Akt   Ras   mTOR   Apoptosis   PAK   NADPH Oxidase   NF-κB   Autophagy  
Cancer   Digestive System Disease   Digestive System Inflammation   Lung Fibrosis  
603
HY-10358 MK-2206 dihydrochloride
MK-2206 dihydrochloride (MK-2206 2HCl) is an orally active pan-AKT inhibitor, with IC50 values of 8 nM, 12 nM and 65 nM against AKT1, AKT2 and AKT3, respectively. MK-2206 dihydrochloride inhibits the Akt/mTOR signaling pathway and reduces the levels of downstream GSK3β and Mcl-1 via proteasomal degradation. MK-2206 dihydrochloride induces G1-phase cell cycle arrest, apoptosis, epithelial-mesenchymal transition, fibroblast activation and extracellular matrix deposition. MK-2206 dihydrochloride causes transient hyperglycemia and hyperinsulinemia in animals. MK-2206 dihydrochloride can be used in research related to solid tumors, renal fibrosis and hypercholesterolemia.
Bcl-2 Family   Akt   mTOR   Apoptosis   GSK-3  
Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Large Cell Lung Carcinoma   Metastatic Breast Cancer   Lung Fibrosis  
494
HY-B0988 Deferoxamine mesylate
Deferoxamine mesylate (Deferoxamine B mesylate) is an iron chelator (binds to Fe(III) and many other metal cations), is widely used to reduce iron accumulation and deposition in tissues. Deferoxamine mesylate upregulates HIF-1α levels with good antioxidant activity. Deferoxamine mesylate also shows anti-proliferative activity, can induce apoptosis and autophagy in cancer cells. Deferoxamine mesylate can be used in studies of diabetes, neurodegenerative diseases as well as anti-cancer and anti-COVID-19.
Autophagy   HIF/HIF Prolyl-Hydroxylase   Reactive Oxygen Species (ROS)   Apoptosis   Akt  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
452
HY-18749 SC79
SC79, a unique specific and BBB permeable Akt activator, activates Akt in the cytosol and inhibits Akt membrane translocation. SC79 specifically binds to the PH domain of Akt.
Akt  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
341
HY-10201 Sorafenib
Sorafenib (Bay 43-9006) is a potent oral active multikinase inhibitor. Sorafenib blocks autophosphorylation and activity of receptor tyrosine kinases (VEGFR-2, VEGFR-3) and RAF family kinases, thereby suppressing the RAF/MEK/ERK and PI3K/Akt pathways, inhibiting STAT3 phosphorylation, and selectively inhibiting the MAPK pathway in cancer cells. Sorafenib induces cell cycle arrest, autophagy, apoptosis, and PARP cleavage, reduces Bcl-2, Bcl-XL, cyclin D1 levels, and activates Bak and Bax. Sorafenib inhibits tumor growth and metastasis in mouse and rat models. Sorafenib can be used for cancer research, such as colon, breast, non-small-cell lung cancer (NSCLC), ovarian, pancreatic, melanoma, colorectal and hepatocellular carcinoma.
Raf   VEGFR   FLT3   Autophagy   Apoptosis   STAT   Akt   MMP   Cadherin   p38 MAPK   ERK   MEK   PI3K   PARP   Bcl-2 Family   Ephrin Receptor   PDGFR  
Gastric Cancer   Liver Cancer   Ovarian Cancer   Digestive System Inflammation   Small Cell Lung Cancer   Non-Small Cell Lung Cancer   Metastatic Breast Cancer   Metastatic Colorectal Cancer   Metastatic Prostate Cancer   Multiple Myeloma   Metastatic Pancreatic Cancer   SARS-CoV-2 Infection   Alzheimer's Disease   Parkinson's Disease   Obesity   Lung Fibrosis  
316
HY-P0175 740 Y-P
740 Y-P (740YPDGFR; PDGFR 740Y-P) is a potent and cell-permeable PI3K activator. 740 Y-P readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone.
PI3K   Autophagy  
Pancreatic Cancer   Depression   Pain   Alzheimer's Disease  
268
HY-18085 Quercetin
Quercetin, a natural flavonoid, is a stimulator of recombinant SIRT1 and also a PI3K inhibitor with IC50 of 2.4 μM, 3.0 μM and 5.4 μM for PI3K γ, PI3K δ and PI3K β, respectively.
PI3K   Autophagy   Mitophagy   Reactive Oxygen Species (ROS)   Apoptosis  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Viral Infection   Pain   Digestive System Inflammation   SARS-CoV-2 Infection   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
230
HY-17386 Rosiglitazone
Rosiglitazone (BRL 49653) is an orally active selective PPARγ agonist (EC50: 60 nM, Kd: 40 nM), with blood-brain barrier permeability. Rosiglitazone is an TRPC5 activator (EC50: 30 μM) and TRPM3 inhibitor. Rosiglitazone can be used in the research of obesity and diabetes, senescence, ovarian cancer.
PPAR   TRP Channel   Autophagy   Ferroptosis   Apoptosis  
Digestive System Disease   Prostate Cancer   Ovarian Cancer   Viral Infection   Depression   Pain   Digestive System Inflammation   Non-Small Cell Lung Cancer   SARS-CoV-2 Infection   Type 2 Diabetes   Obesity  
197
HY-10197 Wortmannin
Wortmannin (SL-2052; KY-12420) is a potent, selective and irreversible PI3K inhibitor with an IC50 of 3 nM. Wortmannin also blocks autophagy formation, and potently inhibits Polo-like kinase 1 (PlK1) and Plk3 with IC50s of 5.8 and 48 nM, respectively.

Source: Penicillium wortmanni

Organoid   PI3K   Polo-like Kinase (PLK)   Autophagy   Antibiotic  
Infection   Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Pain   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
179
HY-D0814 DAPI dihydrochloride
DAPI (4',6-Diamidino-2-phenylindole) dihydrochloride is a DAPI dye. DAPI is a fluorescent dye that binds strongly to DNA. It binds to the AT base pair of the double-stranded DNA minor groove, and one DAPI molecule can occupy three base pair positions. The fluorescence intensity of DAPI molecules bound to double-stranded DNA is increased by about 20 times, and it is commonly observed with fluorescence microscopy, and the amount of DNA can be determined based on the intensity of fluorescence. DAPI cannot penetrate intact cell membranes and is commonly used for staining damaged and fixed cells. DAPI (Compound 3) is an acid-sensing ion channel 3 (ASIC3) inhibitor. DAPI binds to ASIC3 and blocks the channel function. DAPI can be used in the study of chronic pain treatment (Ex/Em = 356/451 nm).
DNA Stain   Sodium Channel  
Neurological, Eye or Ear Disease  
178
HY-15244 Alpelisib
Alpelisib (BYL-719) is an orally active PI3Kα-selective inhibitor that blocks the conversion of PIP2 to PIP3, thereby inhibiting pathways including PI3K/AKT/mTOR, MAPK/ERK, Notch and JAK-STAT. Alpelisib also induces apoptosis, G0/G1 phase arrest and senescence; it significantly inhibits the proliferation, self-renewal, stemness and epithelial-mesenchymal transition (EMT) of tumor cells, reduces cancer stem cell populations and decreases the expression of stem cell markers. Alpelisib not only enhances the sensitivity to Eribulin (HY-13442) and exerts a synergistic effect with Paclitaxel (HY-B0015), but may also induce drug resistance by upregulating the SGK3/GSK3β/β-catenin signaling pathway. Alpelisib can be applied to research related to breast cancer, gastric cancer and lipomas associated with PTEN hamartoma tumor syndrome.
PI3K   Apoptosis  
Colorectal Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Viral Infection   Pain   Non-Small Cell Lung Cancer   Metastatic Breast Cancer   Obesity  
135
HY-P1410 GsMTx4
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology.
TRP Channel   Piezo Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
135
HY-L009 Kinase Inhibitor Library
Kinase is an enzyme that adds phosphate groups to other molecules. This process is known as phosphorylation. Protein phosphorylation is a key aspect in the regulation of a large number of cellular processes including cellular division, metabolism, signal transduction, and so on. There are over 500 kinases encoded by the human genome and it has been estimated that kinases regulate approximately 50% of cellular functions. Kinases are a large group of drug targets in drug discovery. Kinase inhibitors are an important class of drugs that block certain enzymes involved in diseases such as cancer and inflammatory disorders. Kinase inhibitor library designed by MCE contains 3,998 kinase inhibitors and regulators mainly targeting protein kinases (VEGFR, EGFR, BTK, CDK, Akt, etc.), lipid kinases (PI3K, PI4K, SK, etc.) and carbohydrate kinases (Hexokinase), and is a useful tool for kinase drug discovery and related research.

Signaling Pathway Targeting Libraries

125
HY-18723 Yoda 1
Yoda 1 is a potent and selective Piezo1 agonist. Yoda 1 activates purified Piezo1 channels. Yoda 1 potently inhibits macropinocytosis induced by epidermal growth factor (EGF). Yoda 1 enhances Ca2+ influx followed by activation of the calcium-activated potassium channel KCa3.1 and inhibition of Rac1 activation.
Piezo Channel   Akt   ERK   Potassium Channel  
Pancreatic Cancer   Depression   Pain   Digestive System Inflammation   Cardiovascular Disease   Lung Fibrosis  
120
HY-10261 Afatinib
Afatinib (BIBW 2992) is an orally active, potent and irreversible dual specificity inhibitor of ErbB family (EGFR and HER2), with IC50 values of 0.5 nM, 0.4 nM, 10 nM and 14 nM for EGFRwt, EGFRL858R, EGFRL858R/T790M and HER2, respectively. Afatinib can be used for the research of esophageal squamous cell carcinoma (ESCC), non-small cell lung cancer (NSCLC) and gastric cancer.
EGFR   Autophagy   Apoptosis   c-Met/HGFR   Akt   p38 MAPK  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Neurodegenerative Disease   Depression   Pain   Digestive System Inflammation   Hepatitis C Virus Infection   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
113
HY-101840 EIPA
EIPA (L593754) is an orally active TRPP3 channel inhibitor with an IC50 of 10.5 μM. EIPA also enhances autophagy by inhibiting Na+/H+-exchanger 3 (NHE3). EIPA inhibits macropinocytosis as well. EIPA can be used in the research of inflammation and cancers, such as gastric cancer, colon carcinoma, pancreatic carcinoma.
TRP Channel   Prostaglandin Receptor   Autophagy   COX   Na+/H+ Exchanger (NHE)  
Colorectal Cancer   Prostate Cancer   Gastric Cancer   Pancreatic Cancer   Depression   Pain   Rheumatoid Arthritis  
112
HY-B0673 Pirfenidone
Pirfenidone (AMR69) is an antifibrotic agent that attenuates CCL2 and CCL12 production in fibrocyte cells. Pirfenidone has growth-inhibitory effect and reduces TGF-β2 protein levels in human glioma cell lines. Pirfenidone also has anti-inflammatory activities.
TGF-beta/Smad   CCR  
Colorectal Cancer   Prostate Cancer   Viral Infection   Digestive System Inflammation   SARS-CoV-2 Infection   Lung Fibrosis   Rheumatoid Arthritis  
96
HY-15431 Capivasertib
Capivasertib (AZD5363) is an orally active and potent pan-AKT kinase inhibitor with IC50 of 3, 7 and 7 nM for Akt1,Akt2 and Akt3, respectively.
Akt   Autophagy  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Pain   Digestive System Inflammation   Glucose Metabolism   SARS-CoV-2 Infection   Obesity   Lung Fibrosis  
91
HY-L015 PI3K/Akt/mTOR Compound Library
The PI3K/Akt/mTOR pathway controls many cellular processes that are important for the formation and progression of cancer, including apoptosis, transcription, translation, metabolism, angiogenesis, and cell cycle progression. Every major node of this signaling network is activated in a wide range of human tumors. Mechanisms for the pathway activation include activation of receptor tyrosine kinases (RTKs) upstream of PI3K, mutation or amplification of PIK3CA encoding p110α catalytic subunit of PI3K, mutation or loss of PTEN tumor suppressor gene, and mutation or amplification of Akt1. Once the pathway is activated, signaling through Akt can stimulate a series of substrates including mTOR which is involved in protein synthesis. Thus, inhibition of this pathway is an attractive concept for cancer prevention and/or therapy. Currently some mTOR inhibitors are approved for several indications, and there are several novel PI3K/Akt/mTOR inhibitors in clinical trials. MCE owns a unique collection of 1,149 compounds that can be used for PI3K/Akt/mTOR pathway research. PI3K/Akt/mTOR Compound Library also acts as a useful tool for anti-cancer drug discovery.

Signaling Pathway Targeting Libraries

90
HY-10448 Capsaicin
Capsaicin ((E)-Capsaicin), an active component of chili peppers, is a TRPV1 agonist. Capsaicin induces a nociceptive response by binding to its receptors. Capsaicin has analgesic effects on neurological disorders. Capsaicin has antioxidant, anti-inflammatory, anti-cancer effects.
Environmental Pollutants   Endogenous Metabolite   Autophagy   TRP Channel   Apoptosis  
Digestive System Disease   Breast Cancer   Prostate Cancer   Viral Infection   Pain   Digestive System Inflammation   SARS-CoV-2 Infection  
87
HY-L071 Alkaloids Library
Alkaloids are a large and complex group of cyclic compounds that contain N. About 2,000 different alkaloids have been isolated. Important alkaloids include morphine, strychnine, atropine, colchicine, ephedrine, quinine, and nicotine. Alkaloids are useful as diet ingredients, supplements, and pharmaceuticals, in medicine and in other applications in human life. They showed anti-inflammatory, anticancer, analgesics, local anesthetic and pain relief, neuropharmacologic, antimicrobial, antifungal, and many other activities. Alkaloids are also important compounds in organic synthesis for searching new semisynthetic and synthetic compounds with possibly better biological activity than parent compounds. MCE designs a unique collection of 594 alkaloids that all come from natural products. MCE Alkaloids Library is a useful tool for drug discovery that can be used for high throughput screening (HTS) and high content screening (HCS).

Structure Classified Natural Product Libraries

84
HY-L101 Anti-Liver Cancer Compound Library
Liver cancer is one of the leading malignancies which occupies the second position in cancer deaths worldwide, becoming serious threat to human health. Hepatocellular carcinoma (HCC), also known as hepatoma is the most common type accounting for approximately 90% of all liver cancers. Current evidence indicates that during hepatocarcinogenesis, two main pathogenic mechanisms prevail: (1) cirrhosis associated with hepatic regeneration after tissue damage caused by hepatitis infection, toxins or metabolic influences, and (2) mutations occurring in single or multiple oncogenes or tumor suppressor genes. Both mechanisms have been linked with alterations in several important cellular signaling pathways. These include the RAF/MEK/ERK pathway, PI3K/AKT/mTOR pathway, WNT/b-catenin pathway, insulin-like growth factor pathway, c-MET/HGFR pathway , etc. MCE offers a unique collection of 3,003 compounds with identified and potential anti-liver cancer activity. MCE anti-liver cancer compound library is a useful tool for anti-liver cancer drugs screening and other related research.

Disease Focused Libraries

84
HY-L009M Kinase Inhibitor Library Mini
Kinases is a class of enzymes that adds chemicals called phosphates to other molecules, such as sugars or proteins. Protein phosphorylation serves as a critical regulatory mechanism for numerous cellular processes including cell division, metabolism, and signal transduction, with approximately 50% of cellular functions in humans being regulated by kinase activity. In drug discovery, kinases represent a major category of therapeutic targets, and kinase inhibitors constitute an important class of pharmaceuticals that block the activity of specific disease-associated enzymes, particularly in cancer and inflammatory disorders. Small molecule kinase inhibitors represent one of the fastest-growing drug categories, having received U.S. Food and Drug Administration (FDA) approval for both oncological and non-oncological indications. As of September 2023, over 70 FDA-approved small molecule kinase inhibitors are commercially available. The MCE Kinase Inhibitor Library Mini contains 270 kinase inhibitors primarily targeting protein kinases (VEGFR, EGFR, BTK, CDK, Akt, etc.), lipid kinases (PI3K, PI4K, SK, etc.), and carbohydrate kinases. This collection includes 1-3 highly specific representative compounds per target, optimized for screening of kinase-related drug targets in pharmaceutical research.

Signaling Pathway Targeting Libraries

83
HY-L045 Oxygen Sensing Compound Library
Oxygen homeostasis regulation is the most fundamental cellular process for adjusting physiological oxygen variations, and its irregularity leads to various human diseases, including cancer. Hypoxia is closely associated with cancer development, and hypoxia/oxygen-sensing signaling plays critical roles in the modulation of cancer progression. Hypoxia-inducible factor 1 (HIF-1) is a transcription factor that functions as a master regulator of oxygen homeostasis. A variety of HF-1 target genes have been identified thus far which encode proteins that play key roles in critical developmental and physiological processes including angiogenesis/vascular remodeling, erythropoiesis, glucose transport, glycolysis, iron transport, and cell proliferation/survival. HIF-1 is a heterodimeric transcription factor consisting of a constitutively expressed β-subunit and an oxygen-regulated α-subunit. The unique feature of HIF-1 is the regulation of HIF-1α expression and activity based upon the cellular O2 concentration. Under normoxic conditions, hydroxylation of HIF-1α on these different proline residues is essential for HIF proteolytic degradation by promoting interaction with the von Hippel-Lindau tumor-suppressor protein (pVHL) through hydrogen bonding to the hydroxyproline-binding pocket in the pVHL β-domain. As oxygen levels decrease, hydroxylation of HIF decreases; HIF-1α then no longer binds pVHL, and becomes stabilized, allowing more of the protein to translocate to the cell’s nucleus, where it acts as a transcription factor, upregulating (often within minutes) the production of proteins that stimulate blood perfusion in tissues and thus tissue oxygenation. MCE offers a unique collection of 4,317 oxygen sensing related compounds targeting HIF/HIF Prolyl-Hydroxylase, MAPK/ERK, PI3K/AKT signaling pathways, etc. MCE Oxygen Sensing Compound Library is a useful tool to study hypoxia, oxidative stress and discover new anti-cancer drugs.

Signaling Pathway Targeting Libraries

83
HY-L074 Anti-Breast Cancer Compound Library
Breast cancer is the most frequent cancer among women, impacting 2.1 million women each year, and also causes the greatest number of cancer-related deaths among women. Surgery is usually the first type of treatment for breast cancer, which is usually followed by chemotherapy or radiotherapy or, in some cases, hormone or targeted therapies, especially for metastatic breast cancer (MBC). Breast cancer is a heterogeneous disease, which is categorized into 3 major subtypes based on the presence or absence of molecular markers for estrogen or progesterone receptors and human epidermal growth factor 2 (ERBB2; formerly HER2): hormone receptor positive/ERBB2 negative (70% of patients), ERBB2 positive (15%-20%), and triple-negative (tumors lacking all 3 standard molecular markers; 15%). Different intrinsic subtypes exhibit different tumor behavior with different prognoses, and may require specific targeted therapies to maximize treatment effectiveness. Otherwise, some signaling pathways also play important roles in the development of breast cancer, such as NF-κB Signaling Pathway, TGF-beta Signaling Pathway, PI3K/AKT/mTOR signaling pathway and Notch Signaling Pathway. These signaling pathways offer ideal targets for development of new targeted therapies for breast cancer. MCE supplies a unique collection of 3,404 compounds with identified and potential anti-breast cancer activity. MCE Anti-Breast Cancer Compound Library is a useful tool for anti-breast cancer drugs screening.

Disease Focused Libraries

83
HY-L125 Anti-Pulmonary Fibrosis Compound Library
Pulmonary fibrosis (PF), also known as diffuse interstitial pulmonary fibrosis, is a very common end-stage manifestation of several diseases, including idiopathic pulmonary fibrosis (IPF), pulmonary hypertension, and scleroderma, characterised by excessive matrix deposition and destruction of the lung architecture, finally leading to respiratory insufficiency. PF has become a global disease with significantly increased incidence rate, and the most common form of pulmonary fibrosis is idiopathic pulmonary fibrosis (IPF). Lung fibrosis is a complex disease, a multitude of signal factors and signaling pathways is disrupted in this complex disease, such as TGF-β, Wnt, VEGF and PI3K–Akt. MCE offers a unique collection of 2,810 compounds with identified and potential anti-pulmonary fibrosis activity. MCE Anti-Pulmonary Fibrosis Compound Library is a useful tool for anti-pulmonary fibrosis drugs screening and other related research.

Disease Focused Libraries

83
HY-L139 Pain-Related Compound Library
Pain is a kind of distressing feeling caused by the stimulation of tissue damage. According to the International Association for the Study of Pain (IASP), pain is defined as ”An unpleasant sensory and emotional experience associated with actual or potential tissue damage, or described in terms of such damage”. Pain is usually classified according to its location, duration, underlying causes, and intensity. For example, acute and chronic pain, muscle pain, and nerve pain. Pain is the main symptom of most diseases, which seriously affects the quality of life and body function of patients. In the medical treatment of pain, anti-inflammatory drugs and opioid analgesic agents have traditionally been used, but the side effects are serious. In recent years, targeted drugs targeting the ERK/MAPK pathway or other targets have gradually become a research hotspot. MCE supplies a unique collection of 3,530 compounds targeting key proteins in the pain system. MCE Pain-Related Compound Library is a useful tool for pain related research and anti-pain drug development.

Disease Focused Libraries

83
HY-L179 Radiosensitizer Library
Radiotherapy is a common treatment for various cancers, and more than 50% of cancer patients require radiotherapy during the disease treatment. With advances in radiation technology and a better understanding of tumor biology, the efficacy of radiation therapy has gradually improved, and more and more patients have benefited from it. However, even with the use of advanced radiotherapy techniques, there are still many malignant tumor cells with low sensitivity to radiation, leading to the radiation effect is not ideal. To solve this problem, radiosensitizers have received more and more attention. Radiosensitizer is a kind of drug that can enhance the radiosensitivity of tumor cells and improve the effect of radiotherapy. Radiation sensitizers act in a variety of ways, such as killing hypoxic cells, enhancing DNA damage, inhibiting DNA damage repair, and blocking cell cycle progression, making tumor cells more susceptible to radiation damage and death than surrounding normal cells. MCE designs a unique collection of 39 compounds with definite reported radiosensitization. It can be used for drug combination research in anti-cancer treatment.

Compound Characteristic Classified Libraries

83
HY-L212 Neuropeptide Library
Neuropeptides are small proteins produced and released by neurons through the regulation of secretory pathways, expressed in neurons and have transmitter or co-transmitter functions, and are used as nerve substrates. Neuropeptides are by far the largest and most diverse signaling molecules in the brain and have been implicated in the development of diseases and drugs. Neuropeptides are involved in inflammatory and immune diseases and have an impact on epithelial, vascular, and connective tissue cells proliferation and tissue repair. Studies have shown that neuropeptides are particularly important when the nervous system is challenged, such as stress, injury, or substance abuse. Substance P is a neuropeptide that acts as a neurotransmitter and neuromodulator in the central nervous system and is currently in clinical research and has been shown to be involved in inflammatory processes and pain. MCE can provide 128 neuropeptides that can be used for scientific research.
83
HY-L249 Lactylation Compound Library
Protein lactylation, an emerging post-translational modification identified in recent years, plays a critical role in linking cellular metabolic reprogramming, epigenetic regulation, and signaling networks. Based on a systematic framework encompassing lactate metabolism, lactylation, and downstream signaling pathways, this compound library comprehensively targets multiple regulatory layers, including histone modification enzymes (such as p300 and HDACs), key glycolytic enzymes (such as PKM2, LDHA, and GAPDH), transcriptional regulators (such as STAT3, HMGB1, and p53), as well as central signaling pathway nodes including HIF-1α, NF-κB, and PI3K-AKT-mTOR. This integrated design enables a comprehensive representation of the regulatory roles of lactylation across the “metabolism–epigenetics–signaling” axis. MCE has assembled a collection of 6,182 known bioactive compounds and potential functional molecules, making this library suitable for a wide range of applications, including high-throughput drug screening, inhibitor identification, and mechanistic studies. It can be used to systematically evaluate the functional roles of lactylation in biological processes such as tumor metabolism, immune regulation, and inflammatory responses, and to efficiently identify small-molecule candidates with regulatory potential, thereby facilitating the development of innovative therapeutics targeting the interplay between metabolism and epigenetic regulation.

Signaling Pathway Targeting Libraries

83
HY-L923 Ion Channel Lead-like Compound Library
Ion channels are key proteins on the cell membrane that regulate the flow of ions across membranes. They participate in nearly all physiological processes, including nerve conduction, muscle contraction, heart rhythm, and pain perception. Abnormalities in their function can lead to various serious diseases such as arrhythmia, epilepsy, hypertension, neuropathic pain, and cancer. Therefore, ion channels are highly valuable drug targets—over 15% of approved drugs target ion channels currently, demonstrating their irreplaceable therapeutic value in cardiovascular, neurological, and analgesic fields. MCE has collected a library of over 5,000 reported ion channel-related bioactive compounds targeting major sites such as Na+ channels, K+ channels, Ca2+ channels, GABA receptors, iGluRs, and others. Using AI models, these compounds are characterized through both 2D representations (molecular fingerprints, pharmacophores) and 3D representations (3D conformation) to screen for a collection of lead-like compounds highly similar to known active molecules. Additionally, an hERG channel prediction algorithm integrating XGB and ISE mapping strategy is employed to assess and exclude potential cardiotoxicity in the library.. This step significantly reduces safety risks in subsequent screenings, particularly for ion channel drug development related to cardiovascular systems (e.g., Nav1.5, Cav1.2), effectively minimizing failures due to hERG inhibition and serving as a valuable tool for ion channel drug screening.

Focused and target libraries

83
HY-W009724 2-Aminoethyl diphenylborinate
2-Aminoethyl diphenylborinate (2-APB) is a cell-permeable inhibitor of Inositol triphosphate receptor (IP3R). 2-Aminoethyl diphenylborinate also inhibits the store-operated Ca2+ (SOC) channel and activates some TRP channels (V1, V2 and V3). Additionally, 2-Aminoethyl diphenylborinate has inhibitory effects on vasospasm. At high concentrations, it exhibits specific anti-inflammatory and antioxidant effects in neural tissue.
Calcium Channel   TRP Channel   CRAC Channel  
Inflammation or Immune System Disease   Pain   Hypertension   Lung Fibrosis  
82
HY-B0285A Amiloride hydrochloride
Amiloride hydrochloride (MK-870 hydrochloride) is an inhibitor of both epithelial sodium channel (ENaC) and urokinase-type plasminogen activator receptor (uTPA). Amiloride hydrochloride is a blocker of polycystin-2 (PC2; TRPP2) channel.
Sodium Channel   TRP Channel   Apoptosis  
Metabolic or Endocrine Disease   Digestive System Disease   Pain   Digestive System Inflammation   Cardiovascular Disease   SARS-CoV-2 Infection  
72
HY-B0285 Amiloride
Amiloride (MK-870) is an inhibitor of both epithelial sodium channel (ENaC) and urokinase-type plasminogen activator receptor (uTPA). Amiloride is a blocker of polycystin-2 (PC2; TRPP2) channel.
Sodium Channel   TRP Channel   Apoptosis  
Metabolic or Endocrine Disease   Digestive System Disease   Pain   Digestive System Inflammation   Cardiovascular Disease  
72
HY-18234A Leupeptin hemisulfate
Leupeptin hemisulfate is a broad-spectrum protease inhibitor. By inhibiting the activation of the PTEN/PI3K/Akt/NF-κB/ERK1/2/p38 signaling pathway, Leupeptin hemisulfate significantly reduces LPS-induced NO and ROS production, mitochondrial membrane potential hyperpolarization, phagocytic activity, pro-inflammatory cytokine release, and M1 polarization in mouse peritoneal macrophages, and reverses autophagic flux impairment. It also decreases Concanavalin A (HY-P2149)-induced proliferation index of mouse splenic lymphocytes and the Th1/IL-10 and Th2/IL-10 cytokine ratios, thereby modulating innate and adaptive immune responses. Leupeptin hemisulfate inhibits blood coagulation and tumorigenesis in mouse skin. Leupeptin hemisulfate can be used in research on chronic inflammatory diseases and skin tumorigenesis.

Source: Streptomyces roseus MB-26-AI

Ser/Thr Protease   Cathepsin   Autophagy   SARS-CoV   Atg8/LC3   NO Synthase   COX   p62   Arginase   PTEN   NF-κB   PI3K   Akt   p38 MAPK   ERK   Reactive Oxygen Species (ROS)  
Inflammation or Immune System Disease   Respiratory Disease   Coronavirus Infection   Skin Disease  
68
HY-100965 Diphenyleneiodonium chloride
Diphenyleneiodonium chloride is a NADPH oxidase (NOX) inhibitor and also functions as a TRPA1 activator with an EC50 of 1 to 3 μM. Diphenyleneiodonium chloride selectively inhibits intracellular reactive oxygen species.
TRP Channel   NADPH Oxidase   Reactive Oxygen Species (ROS)  
Inflammation or Immune System Disease   Pain   Lung Fibrosis  
66
HY-15640 Capsazepine
Capsazepine is a synthetic analogue of the sensory neurone excitotoxin, and an antagonist of TRPV1 receptor with an IC50 of 562 nM.
TRP Channel   Apoptosis  
Cancer   Digestive System Disease   Pain   Digestive System Inflammation  
65
HY-13004 Maraviroc
Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV.
CCR   HIV  
Metabolic or Endocrine Disease   Pancreatic Cancer   Viral Infection   Digestive System Inflammation   SARS-CoV-2 Infection   Lung Fibrosis   Rheumatoid Arthritis  
60
HY-111783 AZD-7648
AZD-7648 is a potent, orally active, selective DNA-PK inhibitor with an IC50 of 0.6 nM. AZD-7648 induces apoptosis and shows antitumor activity.
DNA-PK   ATM/ATR   PI3K   Apoptosis  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Pain   Digestive System Inflammation   SARS-CoV-2 Infection   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
57
HY-B0545 Probenecid
Probenecid is a potent and selective agonist of transient receptor potential vanilloid 2 (TRPV2) channels. Probenecid also inhibits pannexin 1 channels.
TRP Channel   Bacterial   HIV  
Cancer   Metabolic or Endocrine Disease   Viral Infection   Bacterial Infection   Pain  
50
HY-15418 RS 504393
RS 504393 is a selective CCR2 chemokine receptor antagonist (IC50 values are 89 nM and > 100 μM for inhibition of human recombinant CCR2 and CCR1 receptors respectively).
CCR  
Cancer   Metabolic or Endocrine Disease   Digestive System Disease   Digestive System Inflammation   Lung Fibrosis   Rheumatoid Arthritis  
33
HY-50674 INCB3344
INCB3344 is a potent, selective and orally bioavailable CCR2 antagonist with IC50 values of 5.1 nM (hCCR2) and 9.5 nM (mCCR2) in binding antagonism and 3.8 nM (hCCR2) and 7.8 nM (mCCR2) in antagonism of chemotaxis activity.
CCR  
Cancer   Metabolic or Endocrine Disease   Digestive System Disease   Digestive System Inflammation   Lung Fibrosis   Rheumatoid Arthritis  
30
HY-14536 Methylene Blue
Methylene blue (Basic Blue 9) is a guanylyl cyclase (sGC), monoamine oxidase A (MAO-A) and NO synthase (NOS) inhibitor. Methylene blue is a vasopressor and is often used as a dye in several medical procedures. Methylene blue through the nitric oxide syntase/guanylate cyclase signalling pathway to reduce prepulse inhibition. Methylene blue is a REDOX cycling compound and able to cross the blood-brain barrier. Methylene blue is a Tau aggregation inhibitor. Methylene Blue is a photosensitizer and redox agent. Methylene blue reduces cerebral edema, attenuated microglial activation and reduced neuroinflammation.
Environmental Pollutants   Microtubule/Tubulin   Guanylate Cyclase   Monoamine Oxidase   NO Synthase  
Infection   Neurological, Eye or Ear Disease   Breast Cancer  
30
HY-B0498 Bindarit
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity.
CCR  
Cancer   Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease   Digestive System Disease   Digestive System Inflammation   SARS-CoV-2 Infection   Lung Fibrosis   Rheumatoid Arthritis  
29
HY-12080 BX471
BX471 (ZK-811752) is an orally active, potent and selective non-peptide CCR1 antagonist with a Ki of 1 nM, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
CCR  
Cancer   Metabolic or Endocrine Disease   Digestive System Disease   Digestive System Inflammation   Lung Fibrosis   Rheumatoid Arthritis  
29
HY-18611A Abaucin
RS102895 is a potent CCR2 antagonist, with an IC50 of 360 nM, and shows no effect on CCR1.
CCR  
Cancer   Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease   Digestive System Disease   Digestive System Inflammation   Lung Fibrosis   Rheumatoid Arthritis  
28
HY-B0185 Lidocaine
Lidocaine (Lignocaine) inhibits sodium channels involving complex voltage and using dependence. Lidocaine decreases growth, migration and invasion of gastric carcinoma cells via up-regulating miR-145 expression and further inactivation of MEK/ERK and NF-κB signaling pathways. Lidocaine is an amide derivative and has potential for the research of ventricular arrhythmia.
Sodium Channel   MEK   ERK   NF-κB   Apoptosis  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Viral Infection   Depression   Pain   Digestive System Inflammation   Cardiovascular Disease   SARS-CoV-2 Infection   Obesity   Rheumatoid Arthritis  
23
HY-N1584 Halofuginone
Halofuginone (RU-19110), a Febrifugine derivative, is a competitive prolyl-tRNA synthetase inhibitor with a Ki of 18.3 nM. Halofuginone is a specific inhibitor of type-I collagen synthesis and attenuates osteoarthritis (OA) by inhibition of TGF-β activity. Halofuginone is also a potent pulmonary vasodilator by activating Kv channels and blocking voltage-gated, receptor-operated and store-operated Ca2+ channels. Halofuginone has anti-malaria, anti-inflammatory, anti-cancer, anti-fibrosis effects.
DNA/RNA Synthesis   TGF-beta/Smad   Parasite   Sodium Channel   Calcium Channel  
Inflammation or Immune System Disease   Ovarian Cancer   Parasitic Infection   Pulmonary Hypertension  
22
HY-B1204 Histamine
Histamine is the agonist for histamine receptor and a vasodilator. Histamine is an organic nitrogen compound that participates in local immune responses, regulates intestinal physiological functions, and acts as a neurotransmitter. Histamine affects p38 MAPK/Akt signaling pathway, exhibits antitumor, antioxidant and anti-inflammatory activities. Histamine can be used in the research of acute myeloid leukemia, malignant melanoma, and renal cell carcinoma.
Histamine Receptor   Reactive Oxygen Species (ROS)   Akt   Endogenous Metabolite   p38 MAPK   Apoptosis  
Metabolic or Endocrine Disease   Lung Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Neurodegenerative Disease   Depression   Pain   Digestive System Inflammation   SARS-CoV-2 Infection   Hypertension  
22
HY-10448A Capsaicin (Purity 65%)
Capsaicin (Purity 65%) is a mixture of Capsaicin and Dihydrocapsaicin (Ratio >2:1). Capsaicin (Purity 65%) is an orally active capsaicin receptor (TRPV1) agonist.
TRP Channel   Autophagy   Apoptosis   Endogenous Metabolite  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
21
HY-B0633A Hyaluronic acid
Hyaluronic acid is a biopolymer composed of repeating units of disaccharides with various applications. Hyaluronic acid is a major component of the extracellular matrix (ECM). Hyaluronic acid is synthesized at the plasma membrane. Increased hyaluronic acid levels are associated with tumor cell growth, adhesion, migration, invasion and angiogenesis in digestive cancers. Hyaluronic acid participates in tissue remodeling and rapid cell proliferation in some physiological processes including embryonic morphogenesis and wound-healing. Hyaluronic acid activates the PI3K-Akt signaling. Hyaluronic acid acts as a regulator of cancer-associated lymphangiogenesis. Hyaluronic acid also enhances cell invasion and angiogenesis by promoting proteolytic MMP-9 binding to cell surface or stimulating MMP-9 binding to cell surface. Hyaluronic acid can be used as drug delivery for sodium butyrate to improve the anti-proliferative activity on breast cancer cell line. Hyaluronic acid can be studied in joint diseases, wound healing and cancer.
Endogenous Metabolite   Bacterial   Akt   PI3K  
Breast Cancer   Prostate Cancer   Pancreatic Cancer   Bacterial Infection   Depression   Pain   Digestive System Inflammation   SARS-CoV-2 Infection  
21
HY-B0246 Carbamazepine
Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC50 of 131 μM. Carbamazepine blocks voltage gated Na+, Ca2+, and K+ channels, and is also a HDAC inhibitor (IC50: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain.
Sodium Channel   Autophagy   Mitophagy   Potassium Channel   Calcium Channel   HDAC  
Breast Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Viral Infection   Digestive System Inflammation   SARS-CoV-2 Infection   Alzheimer's Disease   Hypertension  
18
HY-B0211 Riluzole
Riluzole is an anticonvulsant agent and belongs to the family of use-dependent Na+ channel blocker which can also inhibit GABA uptake with an IC50 of 43 μM.
Sodium Channel   GABA Receptor  
Cancer   Alzheimer's Disease   Parkinson's Disease  
16
HY-N0021 Verbascoside
Verbascoside is isolated from Acanthus mollis, acts as an ATP-competitive inhibitor of PKC, with an IC50 of 25 μM, and has antitumor, anti-inflammatory and antineuropathic pain activity.
PKC   Apoptosis   Bacterial   HSV  
Cancer   Neurological, Eye or Ear Disease   Digestive System Disease   Viral Infection   Bacterial Infection   Digestive System Inflammation  
15
HY-12688 Succinyl phosphonate
Succinyl phosphonate is a α-Ketoglutarate Dehydrogenase Complex (KGDHC) modulator with neuroprotective activity. Succinyl phosphonate protects this complex, reduces cellular succinyl-CoA concentration, downregulates protein succinylation levels, and inhibits the activity of the α-ketoglutarate dehydrogenase complex. Succinyl phosphonate corrects hypoxic or ethanol-induced behavioral impairments, modulates exploratory behavior and emotional stress responses, and improves hypoxia tolerance. Succinyl phosphonate reduces glutamate excitotoxicity, restores the activity of the α-ketoglutarate dehydrogenase complex, reverses the changes in glutamate dehydrogenase and glutamine synthetase activities induced by β-amyloid (Amyloid-β), modulates cognitive function, and prevents β-amyloid-induced neuronal damage. Succinyl phosphonate improves microglial senescence, alleviates neuroinflammation, reactive oxygen species (ROS) production, lipid peroxidation, and the expression of proinflammatory cytokines. Succinyl phosphonate can be used in the research of Alzheimer's disease, aging-related neuroinflammation, and Parkinson's disease.
Mitochondrial Metabolism   Reactive Oxygen Species (ROS)   Amyloid-β  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
14
HY-12688A Succinyl phosphonate trisodium salt
Succinyl phosphonate trisodium salt is a α-Ketoglutarate Dehydrogenase Complex (KGDHC) modulator with neuroprotective activity. Succinyl phosphonate trisodium salt protects this complex, reduces cellular succinyl-CoA concentration, downregulates protein succinylation levels, and inhibits the activity of the α-ketoglutarate dehydrogenase complex. Succinyl phosphonate trisodium salt corrects hypoxic or ethanol-induced behavioral impairments, modulates exploratory behavior and emotional stress responses, and improves hypoxia tolerance. Succinyl phosphonate trisodium salt reduces glutamate excitotoxicity, restores the activity of the α-ketoglutarate dehydrogenase complex, reverses the changes in glutamate dehydrogenase and glutamine synthetase activities induced by β-amyloid (Amyloid-β), modulates cognitive function, and prevents β-amyloid-induced neuronal damage. Succinyl phosphonate trisodium salt improves microglial senescence, alleviates neuroinflammation, reactive oxygen species (ROS) production, lipid peroxidation, and the expression of proinflammatory cytokines. Succinyl phosphonate trisodium salt can be used in the research of Alzheimer's disease, aging-related neuroinflammation, and Parkinson's disease.
Mitochondrial Metabolism   Reactive Oxygen Species (ROS)   Amyloid-β  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
14
HY-N2333 Resiniferatoxin
Resiniferatoxin ((+)-Resiniferatoxin), is a selective agonist of transient receptor potential vanilloid 1 (TRPV1) receptor agonist. Resiniferatoxin can be isolated from the Euphorbia resinifera plant. Resiniferatoxin eliminates TRPV1+ primary sensory afferents and blunt cardiac sympathetic afferent reflex for a relatively long period.
TRP Channel  
Cancer   Blood or Cardio-cerebrovascular Disease  
14
HY-13406 TAK-779
TAK-779 is a potent and selective nonpeptide antagonist of CCR5 and CXCR3, with a Ki of 1.1 nM for CCR5, and effectively and selectively inhibits R5 HIV-1, with EC50 and EC90 of 1.2 nM and 5.7 nM, respectively, in MAGI-CCR5 cells.
CCR   HIV   CXCR  
Cancer   Metabolic or Endocrine Disease   Digestive System Disease   Viral Infection   Digestive System Inflammation   Lung Fibrosis   Rheumatoid Arthritis  
13
HY-N0131 Stigmasterol
Stigmasterol is an orally acitve, immunomodulatory agent with anti-inflammatory and neuroprotective effect, as well as able to cross the blood-brain barrier. Stigmasterol activates AMPK, which in turn inhibits NF-κB and NLRP3 signaling pathways, reduces microglia-mediated neuroinflammation, and alleviates cognitive impairment and Alzheimer's disease. Stigmasterol regulates M1/M2 polarization of microglia through the TLR4/ NF-κB pathway, thereby reducing neuropathic pain. Stigmasterol can be used for neurodegenerative diseases, inflammatory diseases, and pain management, among others.
MMP   Endogenous Metabolite  
Alzheimer's Disease   Ischemia-Reperfusion Injury  
13
HY-N0728 α-Linolenic acid
α-Linolenic acid (ALA (free base); C18:3 (9Z,12Z,15Z) (free base); C18:3 n-3 (free base)) is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
Environmental Pollutants   PI3K   Akt  
Bladder Cancer   Glioma   Obesity   Hypercholesterolemia  
12
HY-18732A L-NMMA acetate
L-NMMA (Tilarginine) acetate is a non-selective and competitive inhibitor of nitric oxide synthase. L-NMMA acetate inhibits three subtypes, namely nNOS, eNOS, and iNOS, and reduces NO production. L-NMMA acetate alleviates mechanical allodynia, thermal hyperalgesia, and choroidal fibrosis. L-NMMA acetate is applicable to research related to nociception, bone cancer pain, and myopia.
NO Synthase  
Non-Small Cell Lung Cancer   Triple-Negative Breast Cancer   Obesity   Lung Fibrosis  
11
HY-N0104 Curcumol
Curcumol ((-)-Curcumol), a bioactive sesquiterpenoid, possesses numerous pharmacological activities like anticancer, antimicrobial, antifungal, antiviral, and antiinflammatory. Curcumol is a potent inducer of apoptosis in numerous cancer cells via targeting key signaling pathways as MAPK/ERK, PI3K/Akt and NF-κB which are generally deregulated in several cancers.
Apoptosis  
Digestive System Disease   Breast Cancer   Digestive System Inflammation  
9
HY-N0603 20(S)-Ginsenoside Rg3
20(S)-Ginsenoside Rg3 is the main component of Panax ginseng C. A. Meyer. Ginsenoside Rg3 inhibits Na+ and hKv1.4 channel with IC50s of 32.2±4.5 and 32.6±2.2 μM, respectively. 20(S)-Ginsenoside Rg3 also inhibits Aβ levels, NF-κB activity, and COX-2 expression.
Sodium Channel   Potassium Channel   NF-κB   COX   Amyloid-β   Endogenous Metabolite  
Breast Cancer   Colorectal Cancer   Prostate Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   SARS-CoV-2 Infection   Alzheimer's Disease   Obesity   Rheumatoid Arthritis  
9
HY-N0172 Caffeic acid
Caffeic acid is an inhibitor of both TRPV1 ion channel and 5-Lipoxygenase (5-LO).
TRP Channel   Lipoxygenase   Endogenous Metabolite  
Inflammation or Immune System Disease   Prostate Cancer   Pain   SARS-CoV-2 Infection  
9
HY-P7764 MCP-1/CCL2 Protein, Mouse
MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil.

Species: Mouse; Source: E. coli

Cytokines and Growth Factors Chemokine & Receptors CC Chemokines MCP-1/CCL2

9
HY-B0130 Perindopril
Perindopril erbumine is an angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NFκB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure.
Angiotensin-converting Enzyme (ACE)   NF-κB   STAT   Sirtuin  
Lung Cancer   Breast Cancer   Prostate Cancer   Pancreatic Cancer   Pain   Digestive System Inflammation   Hypertension  
8
HY-N0022 Isoacteoside
Isoacteoside is a natural product that can significantly inhibit the formation of glycation end products. Isoacteoside regulates the AKT/PI3K/m-TOR/NF-κB signaling pathway, induces apoptosis in OVCAR-3 cell. Isoacteoside exhibits antitumor, anti-inflammatory, anti-obesity and neuroprotective activities.
Apoptosis   Reactive Oxygen Species (ROS)   Akt   mTOR   PI3K   NO Synthase   COX   p38 MAPK   Toll-like Receptor (TLR)   Amyloid-β  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   Alzheimer's Disease   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
7
HY-148800 Suzetrigine
Suzetrigine (VX-548) is an orally active and highly selective NaV1.8 inhibitor that acts as an analgesic. Suzetrigine is also a blocker of sodium channel protein type 10 subunit alpha. Suzetrigine is promising for research of acute pain after abdominoplasty and bunionectomy.
Sodium Channel  
Neurological, Eye or Ear Disease  
7
HY-N0826 Corynoline
Corynoline is an orally active acetylcholinesterase (AChE) inhibitor with an IC50 of 30.6 μM. Corynoline exhibits multiple activities including anti-inflammatory, antinociceptive, antitumor and analgesic effects. Corynoline can be used in the research of diseases such as tumors and inflammatory pain.
Cholinesterase (ChE)   Keap1-Nrf2   Heme Oxygenase (HO)   COX   NO Synthase   p38 MAPK   JNK   Apoptosis   Bcl-2 Family   Caspase   STAT   Interleukin Related  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
6
HY-P1410C D-GsMTx4 TFA
D-GsMTx4 TFA is a spider peptide and the D enantiomer of GsMTx4 (HY-P1410). D-GsMTx4 TFA inhibits the mechanosensitive ion channel Piezo2. D-GsMTx4 TFA inhibits [Ca2+]i elevation. D-GsMTx4 TFA inhibits mTOR and PI3K-Akt signaling pathways. D-GsMTx4 TFA inhibits mechanical allodynia and thermal hyperalgesia. D-GsMTx4 TFA can be used in researches of mechanical stress, chronic pain and idiopathic pulmonary fibrosis.
Piezo Channel   Calcium Channel   mTOR   PI3K   Akt  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
6
HY-P1410B D-GsMTx4
D-GsMTx4 is a spider peptide and the D enantiomer of GsMTx4 (HY-P1410). D-GsMTx4 inhibits the mechanosensitive ion channel Piezo2. D-GsMTx4 inhibits [Ca2+]i elevation. D-GsMTx4 inhibits mTOR and PI3K-Akt signaling pathways. D-GsMTx4 inhibits mechanical allodynia and thermal hyperalgesia. D-GsMTx4 can be used in researches of mechanical stress, chronic pain and idiopathic pulmonary fibrosis.
Piezo Channel   Calcium Channel   mTOR   PI3K   Akt  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
6
HY-N0717 L-Valine
L-Valine ((S)-Valine) is a nonlinear semiorganic material. L-Valine causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase.
Bacterial   Arginase   Akt  
Breast Cancer   Pancreatic Cancer   Bacterial Infection   Depression   Pain   Digestive System Inflammation   SARS-CoV-2 Infection  
6
HY-W250978 Ovalbumins
Ovalbumins are the major proteins in egg white. Ovalbumins act as an allergen and inducer, and can be applied to mouse models of allergic diseases. Ovalbumins can induce allergic rhinitis in mice via sensitization and nasal challenge. Ovalbumins can be used to establish asthma models.
Ovalbumin, low endotoxin (HY-W250978A) is recommended for model establishment.
Interleukin Related   IFNAR  
Allergic Asthma   Allergic Rhinitis  
6
HY-B1661 Hexamethonium chloride
Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.
Biochemical Assay Reagents  
Blood or Cardio-cerebrovascular Disease  
5
HY-P99188 Carlumab
Carlumab (CNTO 888) is a human anti-CCL2 (chemokine ligand 2) monoclonal antibody. Carlumab binds and neutralises profibrotic activities of human CCL2. Carlumab inhibits tumor growth by reducing macrophage infiltration and decreasing tumor microvascular density. Carlumab can be used for the research of cancer, suah as prostate cancer.

Species: Human

CCR  
Prostate Cancer  
5
HY-117037 FR900359
FR900359 is a depsipeptide selective inhibitor of Gαq/11/14 in mammalia, can inhibits ERK pathway. FR900359 suppresses the proliferation of melanoma cells and decreases of blood pressure. FR900359 also protected against airway hyperreactivity in murine models of allergen sensitization in Ovalbumin, low endotoxin (HY-W250978A)-induced sensitization model of asthma. FR900359 can be used for cancer and cardiovascular disease research.
Apoptosis   ERK  
Cancer   Blood or Cardio-cerebrovascular Disease  
5
HY-N8377 Capsiate
Capsiate, as a capsaicin analogue extracted from a non-pungent cultivar of CH-19 sweet red pepper, is an orally active agonist of TRPV1.
TRP Channel  
Inflammation or Immune System Disease   Pain  
4
HY-113402A Gamma-glutamylcysteine TFA
Gamma-glutamylcysteine TFA (γ-Glu-Cys TFA) is an orally active, blood-brain barrier permeable dipeptide. Gamma-glutamylcysteine TFA activates AMPK, SIRT1, IL-4/STAT6, AC/cAMP/PI3K, IGF-1R/IRS1/PI3K, and Nrf2 signaling pathways; it inhibits NF-κB, JAK1/STAT1/3, MAPKs, cadmium-induced p38 MAPK, JNK, and PI3K/Akt signaling pathways. Gamma-glutamylcysteine TFA regulates macrophage polarization, modulates the trafficking of CD36 and GLUT4, induces glutathione synthesis, improves metabolic dysfunction, reduces lipid deposition, ameliorates glucose homeostasis, inhibits apoptosis (Apoptosis), stabilizes mitochondria, suppresses lipid peroxidation, iron accumulation and ferroptosis (Ferroptosis), reduces ds-HMGB1 levels, reverses mechanical hyperalgesia, and alleviates hepatic lipid droplet formation. Gamma-glutamylcysteine TFA is applicable to research related to inflammatory bowel disease, type 2 diabetes, cadmium-induced neurotoxicity, Alzheimer's disease, cerebral ischemia/reperfusion injury, neuropathy, and alcoholic liver disease.
Interleukin Related   TNF Receptor   Endogenous Metabolite   AMPK   Sirtuin   STAT   PI3K   NF-κB   JAK   p38 MAPK   JNK   Akt   Apoptosis   Ferroptosis  
Blood or Cardio-cerebrovascular Disease   Digestive System Disease   Digestive System Inflammation   Alzheimer's Disease   Inflammatory Bowel Disease  
4
HY-N2258 Poncirin
Poncirin is isolated from Poncirus trifoliata with anti-inflammory activites. Poncirin significantly reduces mechanical hyperalgesia and allodynia in Complete Freund’s Adjuvant (CFA)-induced inflammatory pain models.
Apoptosis  
Digestive System Disease   Digestive System Inflammation  
4
HY-151435 CCR6 antagonist 1
CCR6 antagonist 1 is a CCR6 antagonist that inhibits the CCL20/CCR6 axis. CCR6 antagonist 1 can be used in the research of autoimmune-mediated inflammatory diseases, such as inflammatory bowel diseases (IBDs).
CCR  
Cancer   Digestive System Disease   Digestive System Inflammation   Lung Fibrosis   Rheumatoid Arthritis  
4
HY-113402 Gamma-glutamylcysteine
Gamma-glutamylcysteine (γ-Glu-Cys) is an orally active, blood-brain barrier permeable dipeptide. Gamma-glutamylcysteine activates AMPK, SIRT1, IL-4/STAT6, AC/cAMP/PI3K, IGF-1R/IRS1/PI3K, and Nrf2 signaling pathways; it inhibits NF-κB, JAK1/STAT1/3, MAPKs, cadmium-induced p38 MAPK, JNK, and PI3K/Akt signaling pathways. Gamma-glutamylcysteine regulates macrophage polarization, modulates the trafficking of CD36 and GLUT4, induces glutathione synthesis, improves metabolic dysfunction, reduces lipid deposition, ameliorates glucose homeostasis, inhibits apoptosis (Apoptosis), stabilizes mitochondria, suppresses lipid peroxidation, iron accumulation and ferroptosis (Ferroptosis), reduces ds-HMGB1 levels, reverses mechanical hyperalgesia, and alleviates hepatic lipid droplet formation. Gamma-glutamylcysteine is applicable to research related to inflammatory bowel disease, type 2 diabetes, cadmium-induced neurotoxicity, Alzheimer's disease, cerebral ischemia/reperfusion injury, neuropathy, and alcoholic liver disease.
Endogenous Metabolite   Interleukin Related   TNF Receptor   AMPK   Sirtuin   STAT   PI3K   NF-κB   JAK   p38 MAPK   JNK   Akt   Apoptosis   Ferroptosis  
Blood or Cardio-cerebrovascular Disease   Digestive System Disease   Digestive System Inflammation   Alzheimer's Disease   Inflammatory Bowel Disease  
4
HY-N6691 Veratridine
Veratridine (3-Veratroylveracevine) is a plant neurotoxin, a voltage-gated sodium channels (VGSCs) agonist. Veratridine inhibits the peak current of Nav1.7, with an IC50 of 18.39 µM. Veratridine regulates sodium ion channels mainly by activating sodium ion channels, preventing channel inactivation and increasing sodium ion flow.
Sodium Channel  
Neurological, Eye or Ear Disease  
4
HY-P3467 (Thr4,Gly7)-Oxytocin
(Thr4,Gly7)-Oxytocin, an Oxytocin analogue, is a specific OT receptor agonist. (Thr4,Gly7)-Oxytocin also excites subicular neurons via activation of TRPV1 channels, and depression of K+ channels. .
Oxytocin Receptor   Potassium Channel  
Alzheimer's Disease  
3
HY-P1624A Teduglutide TFA
Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide TFA can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
Nuclear Hormone Receptor 4A/NR4A   FXR  
Inflammation or Immune System Disease  
2
HY-P990071 Fepixnebart
Fepixnebart (LY3016859) is a humanized monoclonal hIgG4 antibody, which binds and neutralizes only TGFα and epiregulin with high affinity. Fepixnebart can be used for the study of diabetic nephropathy and broad-spectrum chronic pain, including diabetic peripheral neuropathic pain (DPNP), signs and symptoms of osteoarthritis (OA), and chronic low back pain (CLBP).

Species: Human

EGFR  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
2
HY-B1024 DL-Panthenol
DL-Panthenol (DL-Pantothenol) is a precursor of pantothenic acid. DL-Panthenol easily penetrates the skin and has effects of deep moisturizing, promoting wound healing and anti-inflammation. DL-Panthenol can also be used as a hair conditioner in cosmetics. DL-Panthenol has low acute toxicity, non-sensitizing property, and no significant genotoxicity or reproductive and developmental toxicity. DL-Panthenol can be applied to the research of cosmetics.
Biochemical Assay Reagents  
Inflammation or Immune System Disease  
2
HY-17568 Nonivamide
Nonivamide is a agonist, which exhibits 4d-EC50 value of 5.1 mg/L in static toxicity tests.
Environmental Pollutants   TRP Channel  
Pain  
2
HY-P10136A IA9 TFA
IA9 TFA (human TREM-2 182-190 TFA) is a potent, CNS-penetrant TREM-2 inhibitor. IA9 TFA can diminish the release of proinflammatory cytokines and suppress joint inflammation and damage in a Collagen (HY-P5003)-induced arthritis (CIA) mouse model. IA9 TFA can be used for neuroinflammation PET imaging. IA9 TFA can be used for Rheumatoid arthritis (RA) and neuroinflammation research.
TREM receptor  
Rheumatoid Arthritis  
2
HY-N6950 Hederacolchiside A1
Hederacolchiside A1, isolated from Pulsatilla chinensis, suppresses proliferation of tumor cells by inducing apoptosis through modulating PI3K/Akt/mTOR signaling pathway. Hederacolchiside A1 has antischistosomal activity, affecting parasite viability both in vivo and in vitro.
PI3K   Akt   mTOR   Parasite   Apoptosis  
Breast Cancer   Pancreatic Cancer   Parasitic Infection   Pain   Digestive System Inflammation  
2
HY-P99463 Batiraxcept
Batiraxcept (AVB-500; AVB-S6-500) is a selective, soluble AXL receptor and GAS6 inhibitor that targets the GAS6-AXL signaling axis. Batiraxcept is orally inactive and does not cross the blood-brain barrier. Batiraxcept competitively binds to GAS6 ((KD <1 nM), preventing its interaction with the AXL receptor tyrosine kinase, thereby inhibiting downstream PI3K/AKT and MAPK signaling pathways, reducing tumor cell glycolysis, angiogenesis, and metastatic potential. Batiraxcept has demonstrated antitumor activity in preclinical models of endometrial, cholangiocarcinoma, and ovarian cancer by inhibiting tumor growth, invasion, and metastasis.
TAM Receptor   PI3K   Akt   p38 MAPK  
Cancer  
2
HY-P4322 H-Ile-Lys-Val-Ala-Val-OH
H-Ile-Lys-Val-Ala-Val-OH is one of the most potent active sites of laminin-1. H-Ile-Lys-Val-Ala-Val-OH promotes cell adhesion, neurite outgrowth, and tumor growth. H-Ile-Lys-Val-Ala-Val-OH stimulates BMMSC population growth and proliferation by activating MAPK/ERK1/2 and PI3K/Akt signalling pathways.
ERK   Akt  
Pancreatic Cancer   Depression   Pain   Digestive System Inflammation  
2
HY-P99019 Fremanezumab
Fremanezumab (TEV-48125) is a humanized lgG2 monoclonal antibody that selectively and potently binds to calcitonin gene related peptide (CGRp) (IC50 values = 7.943 nM). Fremanezumab binds to mouse CGRP with an IC50 value of 19.6 nM. Fremanezumab counteracts anti-inflammatory effects of CGRP in vitro, including CGRP-mediated inhibition of LPS (HY-D1056)-induced microglial activation. Fremanezumab selectively inhibits the activation of Aδ meningeal nociceptors by cortical spreading depression (CSD) in rats. Fremanezumab can be used for the study of inflammation and chronic migraine.

Species: Human

CGRP Receptor  
Inflammation or Immune System Disease   Pain  
2
HY-116035 Nimbolide
Nimbolide is a triterpene compound that can be isolated from neem (Azadirachta indica), possesses anticancer and antiproliferative activity. Nimbolide induces tumor cell apoptosis by inhibiting NF-κB and CDK4/CDK6 kinase. Nimbolide suppresses the Wnt, PI3K-Akt, MAPK and JAK-STAT signaling pathways.
Wnt   NF-κB   CDK   Apoptosis  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Depression   Pain   Digestive System Inflammation   Hypertension   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
2
HY-P1624 Teduglutide
Teduglutide (ALX-0600) is an analog of human glucagon like peptide-2 (GLP-2). Teduglutide can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
Nuclear Hormone Receptor 4A/NR4A   FXR  
Inflammation or Immune System Disease  
2
HY-P10136 IA9
IA9 (human TREM-2 182-190) is a potent, CNS-penetrant TREM-2 inhibitor. IA9 can diminish the release of proinflammatory cytokines and suppress joint inflammation and damage in a Collagen (HY-P5003)-induced arthritis (CIA) mouse model. IA9 can be used for neuroinflammation PET imaging. IA9 can be used for Rheumatoid arthritis (RA) and neuroinflammation research.
TREM receptor  
Rheumatoid Arthritis  
2
HY-P7235 MCP-1/CCL2 Protein, Mouse (HEK293)
MCP-1/CCL2 Protein, Mouse (HEK293) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293) is a mouse MCP-1/CCL2 (Q24-R96) expressed by HEK293.

Species: Mouse; Source: HEK293

Cytokines and Growth Factors Chemokine & Receptors CC Chemokines MCP-1/CCL2

2
HY-P0244A Dermorphin TFA
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain.

Source: the skin of an Amazonian frog

Opioid Receptor  
Neurological, Eye or Ear Disease  
1
HY-N11885 Ferroptosis-IN-1
Ferroptosis-IN-1 is a A. campylantha diterpenes. Ferroptosis-IN-1 inhibits ferroptosis with an EC50 value of 10 μM. Ferroptosis-IN-1 can be used for neuroinflammation diseases research.
Ferroptosis  
Cancer  
1
HY-P5868 mHuwentoxin-IV
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages.
Sodium Channel  
Neurological, Eye or Ear Disease  
1
HY-P1396 GRK2i
GRK2i is a Gβγ-inhibitory peptide that selectively prevents Gβγ-mediated signaling. GRK2i corresponds to the Gβγ-binding domain of GRK2 (G-protein-coupled receptor kinase 2).
G Protein-coupled Receptor Kinase (GRK)  
1
HY-P5524 C12-iE-DAP
C12-iE-DAP (Lauroyl-γ-D-glutamyl-meso-diaminopimelic acid) is a highly potent and selective NOD1 agonist, with an EC50 of 0.027 nM in HEK-Blue cells expressing human NOD1. C12-iE-DAP activates the NOD1/RIPK2 signaling pathway and its downstream p38 MAPK and NF-κB, induces the expression of inflammatory mediators such as IL6 and IL8, and exerts synergistic effects with TLR4, Dectin-1 or Mincle signaling. C12-iE-DAP can be used in studies related to vascular inflammation, tumor metastasis and neuroinflammation.
NOD-like Receptor (NLR)   p38 MAPK   NF-κB   Toll-like Receptor (TLR)  
Cancer   Inflammation or Immune System Disease   CNS Infection  
1
HY-P3431 VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
iGluR  
Neurological, Eye or Ear Disease  
1
HY-P1441A Mambalgin 1 TFA
Mambalgin 1 TFA is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 TFA binds to closed/inactive channel. Mambalgin 1 TFA is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 TFA increases latency of withdrawal response in mouse tail-flick and paw-flick tests.
Sodium Channel  
Neurological, Eye or Ear Disease  
1
HY-N0313 Euphol
Euphol is a tetracyclic triterpene alcohol isolated from the sap of Euphorbia tirucalli with anti-mutagenic, anti-inflammatory and immunomodulatory effects, orally active. Euphol inhibits the monoacylglycerol lipase (MGL) activity via a reversible mechanism (IC50=315 nM). MGL inhibition in the periphery modulates the endocannabinoid system to block the development of inflammatory pain.
MAGL   Endogenous Metabolite  
Inflammation or Immune System Disease  
1
HY-P5524A C12-iE-DAP hydrochloride
C12-iE-DAP hydrochloride (Lauroyl-γ-D-glutamyl-meso-diaminopimelic acid hydrochloride) is a highly potent and selective NOD1 agonist, with an EC50 of 0.027 nM in HEK-Blue cells expressing human NOD1. C12-iE-DAP hydrochloride activates the NOD1/RIPK2 signaling pathway and its downstream p38 MAPK and NF-κB, induces the expression of inflammatory mediators such as IL6 and IL8, and exerts synergistic effects with TLR4, Dectin-1 or Mincle signaling. C12-iE-DAP hydrochloride can be used in studies related to vascular inflammation, tumor metastasis and neuroinflammation.
NOD-like Receptor (NLR)   p38 MAPK   NF-κB   Toll-like Receptor (TLR)  
Cancer   Inflammation or Immune System Disease   CNS Infection  
1
HY-N1471 Liquiritin apioside
Liquiritin apioside is an orally active inhibitor of TRPV1 receptor. Liquiritin apioside selectively inhibits laryngeal chemoreflex (LCR) and has no significant effect on mechanoreflex (LMR). Liquiritin apioside inhibits LCR by inhibiting reactive oxygen species (ROS) and NADPH oxidase, weakening the interaction between ROS and TRPV1. Liquiritin apioside can be used in the research of respiratory-related diseases.
Others  
Inflammation or Immune System Disease  
1
HY-N0717S L-Valine-15N
L-Valine-15N ((S)-Valine-15N) is the 15N-labeled L-Valine (HY-N0717). L-Valine ((S)-Valine) is a nonlinear semiorganic material. L-Valine causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase.
Isotope-Labeled Compounds   Bacterial   Akt   Arginase  
Infection  
1
HY-N0172R Caffeic acid (Standard)
Caffeic acid (Standard) is the analytical standard of Caffeic acid. This product is intended for research and analytical applications. Caffeic acid is an inhibitor of both TRPV1 ion channel and 5-Lipoxygenase (5-LO).
Reference Standards   TRP Channel   Lipoxygenase   Endogenous Metabolite  
Cancer   Inflammation or Immune System Disease  
1
HY-P0244 Dermorphin
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain.

Source: skin of the frog Phyllomedusa sauvagei

Opioid Receptor  
Depression   Pain  
1
HY-N6253 Pinoresinol
Pinoresinol is a lignol of plant origin serving for defense in a caterpillar. Pinoresinol drastically sensitizes cancer cells against TNF-related apoptosis-inducing ligand (TRAIL) -induced apoptosis.
Apoptosis  
Cancer   Digestive System Disease   Digestive System Inflammation  
1
HY-N7526 Naphthazarin
Naphthazarin (DHNQ) is a microtubule depolymerizing agent. Naphthazarin can improve motor function and reduce neuroinflammation in mouse models of Parkinson's disease. Naphthazarin can induce tumor cell apoptosis, autophagy, and cell cycle arrest. Naphthazarin can also induce erythrocyte apoptosis. Naphthazarin can be used in the research of tumors and neurodegenerative diseases.
Apoptosis   Autophagy   PI3K   Akt  
Cancer   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
1
HY-P99302 Lulizumab
Lulizumab (Humanized Anti-CD28 Recombinant Antibody) is an anti-CD28 domain antibody antagonist. Lulizumab inhibits T-cell activation by selectively targeting the CD28 signal. In a sensitized non-human primate kidney transplantation model, when combined with Carfilzomib (HY-10455), Lulizumab can regulate immune cells and prolong the survival time of the graft.

Species: Human

CD28  
Inflammation or Immune System Disease  
1
HY-N2026 Propylparaben
Propylparaben (Propyl parahydroxybenzoate) is an antibacterial preservative that can be produced by plants and bacteria. Propylparaben is an orally active weak estrogen receptor agonist. Propylparaben regulates the PI3K-AKT and JNK signaling pathways, and induces oxidative stress. Propylparaben is commonly used in cosmetics, pharmaceuticals and foods, and can be used in studies related to ovarian aging and myocardial ischemia-reperfusion injury.
Estrogen Receptor/ERR   Bacterial   Sodium Channel   PI3K   JNK   Akt   Apoptosis  
Bacterial Infection   Cerebrovascular Disease  
1
HY-I1124 L-Valine-d8
L-Valine-d8 is a deuterated form of L-Valine (HY-N0717). L-Valine ((S)-Valine) is a nonlinear semiorganic material. L-Valine causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase.
Isotope-Labeled Compounds   Arginase   Akt   Bacterial  
Infection  
1
HY-P990297 Anti-Mouse/Rat/Human CCL2/MCP-1 Antibody (2H5)
Anti-Mouse/Rat/Human CCL2/MCP-1 Antibody (2H5) is an anti-mouse/rat/human CCL2/MCP-1 IgG monoclonal antibody. Anti-Mouse/Rat/Human CCL2/MCP-1 Antibody (2H5) can reverse the immunosuppressive microenvironment by blocking the CCL2 signaling pathway. Anti-Mouse/Rat/Human CCL2/MCP-1 Antibody (2H5) can reduce the secretion of IFN-γ and the infiltration of macrophages. CCL2/MCP-1 Antibody (2H5) can reduce the amount of HIV virus by increasing the proportion of T cells. Anti-Mouse/Rat/Human CCL2/MCP-1 Antibody (2H5) can be used for researches on inflammation conditions, virus infection and cancer such as inflammatory bowel disease (IBD), hepatocellular carcinoma (HCC) and HIV.

Species: Human/Mouse/Rat

CCR   HIV  
Liver Cancer   HIV Infection   Colitis  
1
HY-121608 Lumiflavin
Lumiflavin (Lumiflavine), a riboflavine analog, causes significant inhibition of riboflavine uptake. Lumiflavin can effectively reduce the riboflavin enrichment in cancer stem-like cells (CSCs) and sensitize the effect of cisplatin Diamminedichloroplatinum (DDP) on CSCs. Lumiflavin is promising for research of ovarian cancer.
Fluorescent Dye   Notch  
1
HY-W041892 Dimethyl itaconate
Dimethyl itaconate induces innate immune memory (trained immunity), and exhibits immunomodulatory property. Dimethyl itaconate inhibits the activation of microglia, reduces the neuroinflammation and synaptic structural damage. Dimethyl itaconate regulates the composition of intestinal flora.
Reactive Oxygen Species (ROS)  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
1
HY-W042416 N,N-Dimethylacetamide
N,N-Dimethylacetamide (DMAc) is an organic solvent with blood-brain transmissibility and an FDA-approved drug excipient. N, N-dimethylacetamide exerts anti-inflammatory activity by inhibiting the NF-κB signaling pathway. N, N-dimethylacetamide can be used in studies of weight gain caused by a high-fat diet and neuroinflammation in Alzheimer's disease.
NF-κB  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
1
HY-P3719 MOG(35-55) amide, mouse, rat
MOG (35-55) amide, mouse, rat the terminal amidation form of the 35-55 fragment of the myelin oligodendrocyte glycoprotein (MOG) immunogenic peptide (MOG (35-55) (HY-P1240)). MOG(35-55) amide, mouse, rat can be used for experimental autoimmune encephalomyelitis (EAE) modeling.
CCR  
Inflammation or Immune System Disease  
1
HY-P78173 MCP-1/CCL2 Protein, Human (Biotinylated, HEK293, His-Avi)
MCP-1/CCL2 Protein, Human (Biotinylated, HEK293, His-Avi) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein MCP-1/CCL2 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human MCP-1/CCL2 (Q24-T99) expressed by HEK293 with His and Avi tags at the C-terminus.

Species: Human; Source: HEK293

Cytokines and Growth Factors Biotinylated Proteins Chemokine & Receptors CC Chemokines MCP-1/CCL2

1
HY-P700541 CCR2 Protein, Mouse (N-His, C-Myc)
CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Species: Mouse; Source: E. coli

Cytokines and Growth Factors CD Antigens Receptor Proteins Chemokine & Receptors T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins G-Protein-Coupled Receptors (GPCRs) CC Chemokine Receptor Chemokine Receptor CCR2/CD192

1
HY-P80385 CCR2 Antibody (YA548)
CCR2 Antibody (YA548) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to CCR2.

Host: Rabbit; Reactivity: Human, Mouse

Monoclonal Antibodies Recombinant Antibodies Flow Cytometry Antibodies Primary Antibodies

1
HY-B1203S Fludrocortisone-d5
Fludrocortisone-d5 (9α-Fludrocortisone-d5) is the deuterium labeled Fludrocortisone (HY-B1203). Fludrocortisone is an orally active mineralocorticoid and glucocorticoid receptor agonist. Fludrocortisone suppresses pro-inflammatory cytokine expression, reduces CCL2, IL-6, IL-8 levels, upregulates mineralocorticoid receptor (MR) expression, induces PI3K/Akt, GSK-3β, CREB, ERK1/2, mTOR phosphorylation, blocks Tau hyperphosphorylation, prevents apoptosis, promotes survival and proliferation, enhances renal sodium and water transport, increases plasma volume and blood pressure, reduces plasma potassium and renin activity, stimulates erythropoietin expression, modulates uterine receptivity genes, and reverses PP242-induced MUC1 upregulation. Fludrocortisone can be used for the research of congenital adrenal hyperplasia, postural hypotension, and adrenal insufficiency.
Isotope-Labeled Compounds   Mineralocorticoid Receptor   Glucocorticoid Receptor   Apoptosis  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-10448S1 Capsaicin-d3
Capsaicin-d3 is the deuterium labeled Capsaicin. Capsaicin ((E)-Capsaicin), an active component of chili peppers, is a TRPV1 agonist. Capsaicin induces a nociceptive response by binding to its receptors. Capsaicin has analgesic effects on neurological disorders. Capsaicin has antioxidant, anti-inflammatory, anti-cancer effects.
Isotope-Labeled Compounds   TRP Channel   Autophagy   Apoptosis   Endogenous Metabolite  
Cancer  
/
HY-P992345 DS002
DS002 is a human monoclonal antibody targeting NGF/bNGF, with an IC50 of 6.60 nM against human NGF, 1.98 nM against rat NGF, and 8.46 nM against mouse NGF. DS002 blocks NGF-TrkA binding, interrupts pain signal transduction, inhibits TrkA-mediated downstream signaling pathways, and alters aromatic amino acid metabolic pathways. DS002 inhibits cancer cell proliferation. DS002 exerts a preventive effect on Paclitaxel-, Cisplatin- and Vincristine-induced peripheral neuropathy in rats. DS002 can be used in studies related to chronic pain and chemotherapy-induced peripheral neuropathy.

Species: Human

Trk Receptor  
Pain  
/
HY-128393S2 Trilinolein-d5
Trilinolein-d5 is the deuterium labeled Trilinolein (HY-128393). Trilinolein is an orally active triglyceride that inhibits the PI3K/Akt, Ras/MEK/ERK signaling pathways, and MMP-2. Trilinolein can reduce oxidative stress, induce apoptosis, and inhibit cell migration. Trilinolein can be used in the research fields of cardiovascular disease, cerebrovascular disease (such as cerebral ischemia), and non-small cell lung cancer.
Isotope-Labeled Compounds   ERK   MEK   Apoptosis   Akt   PI3K   MMP   E-Selectin  
/
HY-119447S Mavacoxib-d4
Mavacoxib-d4 is the deuterium labeled Mavacoxib. Mavacoxib is a selective, oral long-acting cyclooxygenase-2 (COX-2) inhibitor and a long-acting non-steroidal anti-inflammatory drug (NSAID). Mavacoxib is used to treat pain and inflammation associated with degenerative joint disease in dogs.
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-P991234 COVA208
COVA208 is a bispecific FynomAb (a fusion protein of an antibody and a Fyn SH3-derived binding protein) that targets HER2. COVA208 induces the degradation of HER2, reduces the levels of HER2, HER3, and EGFR, thereby effectively blocking the downstream signaling pathways of HER2, including the HER3-PI3K-AKT and MAPK pathways, and simultaneously inducing apoptosis of tumor cells. COVA208 is promising for research of cancers, such as HER2-positive breast cancer, gastric cancer, and colorectal cancer.

Species: Human

EGFR   p38 MAPK   PI3K   Akt  
Cancer  
/
HY-P10519A Brevicidine TFA
Brevicidine TFA is an antimicrobial peptide with selective bactericidal activity against Gram-negative pathogens. Brevicidine TFA disrupts bacterial morphology by binding to lipopolysaccharide (LPS) on the bacterial cell membrane to form pores. Brevicidine TFA causes dissipation of intracellular proton motive force, outer membrane damage, inhibition of ATP biosynthesis and reactive oxygen species accumulation in bacterial cells. As a sensitizer, Brevicidine TFA exerts synergistic activity when combined with a variety of conventional antibiotics.
Bacterial   Reactive Oxygen Species (ROS)  
Bacterial Infection  
/
HY-P990248 Anti-Mouse E-Cadherin/CD324 Antibody (DECMA-1)
Anti-Mouse E-Cadherin/CD324 Antibody (DECMA-1) is an anti-mouse E-Cadherin/CD324 IgG1 monoclonal antibody. Anti-Mouse E-Cadherin/CD324 Antibody (DECMA-1) can downregulate the HER signaling axis and PI3K/Akt/mTOR signaling pathway. Anti-Mouse E-Cadherin/CD324 Antibody (DECMA-1) can inhibit the proliferation of tumor cells and induce their apoptosis. Anti-Mouse E-Cadherin/CD324 Antibody (DECMA-1) can be used for researches on cancer and inflammation conditions such as breast cancer, chronic compression injury (CCI) and asthma.

Species: Mouse

Cadherin   EGFR   PERK   Akt   mTOR  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Breast Cancer  
/
HY-P10833 C-VGB3
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising for research of angiogenesis-related cancers, such as breast cancer.
VEGFR   PI3K   Akt   mTOR   ERK   Apoptosis  
Blood or Cardio-cerebrovascular Disease  
/
HY-W712539 Homodihydrocapsaicin II
Homodihydrocapsaicin II is a capsaicinoid with analgesic and anti-inflammatory effects, which is found in capsicum fruits. Homodihydrocapsaicin II is promising for research of inflammatory diseases and neuropathic pain.
Drug Derivative  
/
HY-B1804S1 Tricaprilin-d50
Tricaprilin-d50 (Trioctanoin-d50) is the deuterium labeled Tricaprilin (HY-B1804). Tricaprilin is an orally active and well tolerated ketogenic agent that safely induces ketosis. Tricaprilin restores brain electrical activity and metabolism to help counteract neuroinflammation in migraine. Tricaprilin is promising for research of migraine prevention and Alzheimer’s disease (AD). Tricaprilin is a pure C8 medium chain triglyceride (MCT).
Isotope-Labeled Compounds   Endogenous Metabolite  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-W247103 Rhodamine 19 perchlorate
Rhodamine 19 perchlorate is a metal free organic dye for dye sensitized solar cells.
Fluorescent Dye  
/
HY-P10465 TRPV1-Tat
TRPV1-Tat is an antagonistic peptide that fuses the TRPV1 (transient receptor potential vanilla subtype 1) of the cell-penetrating peptide Tat. TRPV1-Tat blocks this phosphorylation process by competitively binding to the AKAP79 binding site of TRPV1, thereby inhibiting the sensitization of TRPV1. TRPV1-Tat can be used in the study of inflammatory pain.
TRP Channel  
Inflammation or Immune System Disease  
/
HY-161492 Estradiol/OVA
Estradiol/OVA is a multifunctional dye. Dyes are important tools in biological experiments. They can help researchers observe and analyze cell structures, track biomolecules, evaluate cell functions, distinguish cell types, detect biomolecules, study tissue pathology and monitor microorganisms. Their applications range from basic scientific research to clinical A wide range of diagnostics. Dyes are also widely used in traditional fields such as textile dyeing, as well as in emerging fields such as functional textile processing, food pigments and dye-sensitized solar cells.
Fluorescent Dye  
/
HY-P1330 Purotoxin 1
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp.
P2X Receptor  
Inflammation or Immune System Disease  
/
HY-P1175B L-R4W2 acetate
L-R4W2 acetate is a potent antagonist of vanilloid receptor 1 (VR1, TRPV1), with an IC50 of 0.1 μM. L-R4W2 acetate may act as a potent analgesic.
TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-P992200 Anti-CD146 Antibody (AA98)
Anti-CD146 Antibody (AA98) is an antibody targeting CD146 and an angiogenesis inhibitor. Anti-CD146 Antibody (AA98) blocks the dimerization of CD146 as well as its downstream PI3K/AKT, p38 MAPK and NF-κB signaling pathways; it inhibits the expression of MMP9 and ICAM1, epithelial-mesenchymal transition (EMT), and the proliferation, migration and tube formation of endothelial cells. Anti-CD146 Antibody (AA98) enhances radiation-induced cancer cell apoptosis and survival inhibition, reduces tumor microvessel density, and suppresses tumor growth, invasion and vasculogenic mimicry. Anti-CD146 Antibody (AA98) can be used in research related to cervical cancer, liver cancer, malignant phyllodes tumor of the breast, uveal melanoma, leiomyosarcoma, pancreatic cancer, other tumors and angiogenesis.

Species: Human

Transmembrane Glycoprotein   PI3K   Akt   p38 MAPK   NF-κB   MMP   Apoptosis   Caspase   Bcl-2 Family  
Blood or Cardio-cerebrovascular Disease   Liver Cancer   Cervical Cancer   Pancreatic Cancer   Melanoma  
/
HY-N19281 Puberulin
Puberulin is a coumarin compound and an orally effective analgesic. Puberulin is present in Choisya ternata var. Sundance. Puberulin exerts analgesic activity against chemical and heat-induced pain agents in mouse models, and this activity does not involve opioid receptors or muscarinic receptors. Puberulin can be used in the research of neuropathic pain.
Drug Derivative  
Pain  
/
HY-P5770 Jingzhaotoxin-V
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM).
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-178305S L-Valine-d
L-Valine-d is the deuterium labeled L-Valine (HY-N0717). L-Valine ((S)-Valine) is a nonlinear semiorganic material. L-Valine causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase.
Isotope-Labeled Compounds   Akt   Arginase   Bacterial  
Infection  
/
HY-P10992 YVPGP
YVPGP is an oligopeptide exacted from Anthopleura anjunae. YVPGP has a significant antitumor activity by mediating PI3K/AKT/mTOR signaling pathway. YVPGP arrests DU-145 cells in the S phase and induces apoptosis via mitochondrial and death receptor pathways (caspase3, 7, 8, 9). YVPGP effectively inhibits tumor growth in DU-145 xenografts mice model, promising for prostate cancer research.
PI3K   Akt   mTOR   Caspase   Apoptosis   Bcl-2 Family  
/
HY-B1837S Cyfluthrin-d6
Cyfluthrin-d6 (β-Cyfluthi-d6) is deuterium labeled Cyfluthrin. Cyfluthrin is a type II pyrethroid and has effects on various insects. Cyfluthrin is a modulator of Nav1.8 sodium channels by repetitive stimulation. Cyfluthrin can be applied in agriculture,veterinary, insecticide,pyrethroid and stored product.
Isotope-Labeled Compounds   Sodium Channel  
Infection  
/
HY-P10464 Tat-AKAP79 (326-336)
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia.
TRP Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-17474AS Parecoxib-d5 sodium
Parecoxib-d5 sodium is the deuterium labeled Parecoxib sodium. Parecoxib Sodium (SC 69124A) is a highly selective and orally active COX-2 inhibitor, the proagent of Valdecoxib (HY-15762). Parecoxib Sodium is a nonsteroidal anti-inflammatory agent (NSAID) and inhibits prostaglandin (PG) synthesis. Parecoxib Sodium can be used for the relief of acute postoperative pain and symptoms of chronic inflammatory conditions such as osteoarthritis and rheumatoid arthritis in vivo.
Isotope-Labeled Compounds   COX  
Cancer   Inflammation or Immune System Disease  
/
HY-B0863S5 Glyphosate-13C,15N-1
Glyphosate-13C,15N-1 is the 13C- and 15N-labeled Glyphosate (HY-B0863). Glyphosate, a non-selective systemic biocide with broad-spectrum activity, is an herbicidal derivative of the amino acid glycine. Glyphosate inhibits the enzymatic activity of the 5-endopyruvylshikimate 3-phosphate synthase (EPSPS) in the shikimic acid pathway, preventing the synthesis of the aromatic amino acids tyrosine, phenylalanine, and tryptophan. Glyphosate induces oxidative stress, neuroinflammation, and mitochondrial dysfunction, processes that lead to neuronal death by autophagia, necrosis, or apoptosis, as well as the appearance of behavioral and motor disorders.
Isotope-Labeled Compounds   Necroptosis   Autophagy   Apoptosis  
Neurological, Eye or Ear Disease  
/
HY-P1175A L-R4W2 TFA
L-R4W2 TFA is a potent antagonist of vanilloid receptor 1 (VR1, TRPV1), with an IC50 of 0.1 μM. L-R4W2 TFA may act as a potent analgesic.
TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-A0057AS2 Gabapentin-d4 hydrochloride
Gabapentin-d4 hydrochloride is the deuterium labeled Gabapentin hydrochloride (HY-A0057A). Gabapentin hydrochloride is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain.
Isotope-Labeled Compounds   Calcium Channel  
Cancer   Neurological, Eye or Ear Disease  
/
HY-P11553 ECL1i
ECL1i is an allosteric, selective CCR2 inhibitor. ECL1i specifically inhibits CCL2-/CCR2-mediated chemotaxis. ECL1i interferes with CCR2-positive cell recruitment and attenuates disease progression in experimental autoimmune encephalomyelitis.
CCR  
Autoimmune Disease  
/
HY-B0619S1 Zaltoprofen-13C,d3
Zaltoprofen-13C,d3 is the 13C- and deuterium labeled Zaltoprofen. Zaltoprofen (CN100), a non-steroidal anti-inflammatory drug (NSAID), is a preferential and orally active COX-2 inhibitor, with IC50s of 1.3 and 0.34 μM for COX-1 and COX-2, respectively. Zaltoprofen exhibits powerful anti-inflammatory effects as well as an analgesic action on inflammatory pain.
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-10448S4 Capsaicin-d7
Capsaicin-d7 is deuterated labeled Capsaicin (HY-10448). Capsaicin ((E)-Capsaicin), an active component of chili peppers, is a TRPV1 agonist. Capsaicin induces a nociceptive response by binding to its receptors. Capsaicin has analgesic effects on neurological disorders. Capsaicin has antioxidant, anti-inflammatory, anti-cancer effects.
TRP Channel   Apoptosis   Endogenous Metabolite   Autophagy   Isotope-Labeled Compounds  
Cancer  
/
HY-17474S Parecoxib-d3
Parecoxib-d3 is the deuterium labeled Parecoxib. Parecoxib (SC 69124) is a highly selective and orally active COX-2 inhibitor, the proagent of Valdecoxib (HY-15762). Parecoxib Sodium is a nonsteroidal anti-inflammatory agent (NSAID) and inhibits prostaglandin (PG) synthesis. Parecoxib can be used for the relief of acute postoperative pain and symptoms of chronic inflammatory conditions such as osteoarthritis and rheumatoid arthritis in vivo.
Isotope-Labeled Compounds   COX  
Cancer   Inflammation or Immune System Disease  
/
HY-P11022 TL-119
TL-119 (A-3302-B) is a polypeptide. TL-119 can be isolated from the bacteria Micromonospora sp. MAG 9-7 and Saccharomonospora sp. CNQ-490. TL-119 inhibits TRPV-1. TL-119 exhibits antiviral activity against HSV-2. TL-119 possesses anticancer activity against gastric cancer and colorectal cancer.
Endogenous Metabolite   HSV   TRP Channel  
Colorectal Cancer   Gastric Cancer   Bacterial Infection   HSV Infection  
/
HY-P11130 LQEQ-19 (mouse, rat)
LQEQ-19 (mouse, rat) is a VGF derived peptide that exerts neuroprotective effects. LQEQ-19 (mouse, rat) activates the PI3K/Akt and MEK/ERK signaling pathways by promoting phosphorylation of Akt and ERK1/2. LQEQ-19 (mouse, rat) is commonly used in the study of neurological conditions.
Akt   ERK   PI3K   MEK  
Neurological, Eye or Ear Disease  
/
HY-N8501 Emestrin
Emestrin is a mycotoxin originally isolated from E. striata that has antimicrobial, immunomodulatory, and cytotoxic activities. It is active against the fungi C. albicans and C. neoformans, as well as the bacteria E. coli, S. aureus, and methicillin-resistant S. aureus (MRSA; IC50s=3.94, 0.6, 2.21, 4.55, and 2.21 μg/mL, respectively).2 Emestrin is a chemokine (C-C motif) receptor 2 (CCR2) antagonist (IC50=5.4 μM in a radioligand binding assay using isolated human monocytes).3 Emestrin (0.1 μg/mL) induces apoptosis in HL-60 cells. It induces heart, thymus, and liver tissue necrosis in mice when administered at doses ranging from 18 to 30 mg/kg.

Source: Emericella foveolata

Bacterial  
Staphylococcus Aureus Infection  
/
HY-W654381 N-Vanillylnonanamide-d3
N-Vanillylnonanamide-d3 is the deuterium labeled Nonivamide (HY-17568). Nonivamide is a 50 value of 5.1 mg/L in static toxicity tests.
Isotope-Labeled Compounds   TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-P3223 Biphalin TFA
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-P991478 RLVT-14-02
RLVT-14-02 is a human monoclonal antibody (mAb) targeting MMP14. RLVT-14-02 can be used in neuropathic pain research.

Species: Human

MMP  
Neurological, Eye or Ear Disease  
/
HY-P2786A Phrixotoxin 2
Phrixotoxin 2 is a Kv4 family potassium channel inhibitor, with Ki values in rats of 120 nM for Kv4.2, 110 nM for Kv4.3, and 230 nM for Kv4.1. Phrixotoxin 2 mediates voltage-dependent inhibition of Kv4.2 and Kv4.3 currents, and voltage-independent inhibition of Kv4.1 currents. Phrixotoxin 2 fails to inhibit A-type K+ currents in visceral dorsal root ganglion neurons. Phrixotoxin 2 induces contraction of non-pregnant uterine smooth muscle and triggers orofacial cold hyperalgesia in rats. Phrixotoxin 2 can distinguish the contribution of Kv4 subunits to A-type K+ currents in different subsets of sensory neurons. Phrixotoxin 2 can be used in research related to chronic pain and trigeminal neuropathic pain.
Potassium Channel  
Muscle Disease   Chronic Pain  
/
HY-P11831 RD-pepcan-11
RD-pepcan-11 is a CB1 receptor agonist. RD-pepcan-11 increases the relative phosphorylation level of ERK1/2. RD-pepcan-11 mediates analgesic effects through interaction with CB1 receptors in a carrageenan-induced mouse inflammatory pain model. RD-pepcan-11 can be used in studies related to inflammatory pain.
Cannabinoid Receptor   PERK  
Inflammation or Immune System Disease  
/
HY-182539 DD04107
DD04107 is a neuronal exocytosis inhibitor with a rat Syt1-C2B domain binding Kd of 2.4 μM. DD04107 interferes with synaptobrevin-syntaxin-SNAP-25 complex formation and Syt1-SNARE complex interaction to block α-calcitonin gene-related peptide (α-CGRP) exocytotic release from primary sensory neurons. DD04107 blocks inflammatory ion channel recruitment to nociceptor plasma membranes. DD04107 can be used for the research of chronic inflammatory pain, neuropathic pain, osteosarcoma pain, chemotherapy-induced peripheral neuropathy, diabetic neuropathy, inflammatory pain.
CGRP Receptor  
Pain  
/
HY-B1203S1 Fludrocortisone-d2
Fludrocortisone-d2 (9α-Fludrocortisone-d2) is the deuterium labeled Fludrocortisone (HY-B1203). Fludrocortisone is an orally active mineralocorticoid and glucocorticoid receptor agonist. Fludrocortisone suppresses pro-inflammatory cytokine expression, reduces CCL2, IL-6, IL-8 levels, upregulates mineralocorticoid receptor (MR) expression, induces PI3K/Akt, GSK-3β, CREB, ERK1/2, mTOR phosphorylation, blocks Tau hyperphosphorylation, prevents apoptosis, promotes survival and proliferation, enhances renal sodium and water transport, increases plasma volume and blood pressure, reduces plasma potassium and renin activity, stimulates erythropoietin expression, modulates uterine receptivity genes, and reverses PP242-induced MUC1 upregulation. Fludrocortisone can be used for the research of congenital adrenal hyperplasia, postural hypotension, and adrenal insufficiency.
Isotope-Labeled Compounds   Mineralocorticoid Receptor   Glucocorticoid Receptor   Apoptosis  
Cancer   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P1193 GR 82334
GR 82334 is a potent and specific reversible tachykinin NK1 receptor antagonist. GR 82334 inhibits substance P-induced sensitization by blocking SP NK1 receptors in naked mole-rats.
Neurokinin Receptor  
Neurological, Eye or Ear Disease  
/
HY-P11249 Mr1.1[S4Dap, C16Pen]
Mr1.1[S4Dap, C16Pen] is a highly active and selective nAChR (human α9α10 nAChR IC50 = 4.0 nM, rat α9α10 nAChR IC50 = 2.7 nM) inhibitor. Mr1.1[S4Dap, C16Pen] can significantly relieve pain and has significant stability. Mr1.1[S4Dap, C16Pen] can be used for the study of neuropathic pain.
nAChR  
Neurological, Eye or Ear Disease  
/
HY-P5180 Hainantoxin-III
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-P991984 SIBP-03
SIBP-03 is a specifical anti-HER3 antibody. SIBP-03 binds strongly and specifically to recombinant HER3 protein. SIBP-03 inhibits HER3 activation, as well as the downstream PI3K/AKT signaling pathway. SIBP-03 exhibits anticancer activity against squamous cell carcinoma, non-small cell lung cancer, gastric cancer, and breast cancer. SIBP-03 synergistically enhances the antitumor activity of DS-8201 (HY-138298A) and Cetuximab (HY-P9905).

Species: Human

EGFR   PI3K   Akt  
Gastric Cancer   Non-Small Cell Lung Cancer   HER-2 Positive Breast Cancer   Squamous Cell Carcinoma  
/
HY-90006S3 5-Fluorouracil-13C4,15N2
5-Fluorouracil-13C4,15N2 is the 13C and 15N labeled 5-Fluorouracil. 5-Fluorouracil (5-FU) is an analogue of uracil and a potent antitumor agent. 5-Fluorouracil affects pyrimidine synthesis by inhibiting thymidylate synthetase thus depleting intracellular dTTP pools. 5-Fluorouracil induces apoptosis and can be used as a chemical sensitizer. 5-Fluorouracil also inhibits HIV.
Exosomes   Apoptosis   Nucleoside Antimetabolite/Analog   HIV   Endogenous Metabolite  
Cancer  
/
HY-10863S2 Anandamide-15N
Anandamide-15N (AEA-15N) is the 15N-labeled Anandamide (HY-10863). Anandamide is an endocannabinoid. Anandamide modulates both neuronal and immune functions through two protein-coupled cannabinoid receptors (CB1 and CB2). Anandamide can activate numerous other receptors like PPARS, TRPV1, and GPR18/GPR55. Anandamide also has potential anti-fungal and anti-inflammatory activities. Anandamide can be used for the research of Alzheimer’s disease (AD) and ulcerative colitis.
Isotope-Labeled Compounds   TRP Channel   Tau Protein   PPAR   Fungal   Cannabinoid Receptor   GPR55   Endogenous Metabolite  
Infection   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
/
HY-D1291A Photoacoustic contrast agent-1 perchlorate
Photoacoustic contrast agent-1 perchlorate (Compound F-1) is a photo/sono-sensitizer that can produce a significant cell killing effect under illuminated conditions. Photoacoustic contrast agent-1 perchlorate can be used in the research of tumor diagnosis and treatment. Photoacoustic contrast agent-1 perchlorate is a multifunctional dye. Dyes are important tools in biological experiments. They can help researchers observe and analyze cell structures, track biomolecules, evaluate cell functions, distinguish cell types, detect biomolecules, study tissue pathology and monitor microorganisms. Their applications range from basic scientific research to clinical A wide range of diagnostics. Dyes are also widely used in traditional fields such as textile dyeing, as well as in emerging fields such as functional textile processing, food pigments and dye-sensitized solar cells.
Fluorescent Dye  
/
HY-P10320 T3 Peptide
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts.
PI3K   Akt  
Blood or Cardio-cerebrovascular Disease  
/
HY-135731AS 4-Methylamino antipyrine-d3 hydrochloride
4-Methylamino antipyrine-d3 (hydrochloride) is deuterium labeled 4-Methylamino antipyrine (hydrochloride). 4-Methylamino antipyrine hydrochloride is an active metabolite of Metamizole. Metamizole is a pyrazolone non-steroidal anti-inflammatory drug (NSAID) and inhibits COX. Metamizole is an nonopioid analgesic agent and can be used for pain and fever. 4-Methylamino antipyrine hydrochloride has analgesic, antipyretic, and relatively weak antiinflammatory properties.
Isotope-Labeled Compounds   COX   Drug Metabolite  
Inflammation or Immune System Disease  
/
HY-NP187 Phytolacca americana Lectin
Phytolacca americana Lectin (PWM) is an acidic monomeric glycoprotein specific to N-acetylglucosamine and a B cell-specific stimulator. Phytolacca americana Lectin acts as a mitogen to induce cell mitosis. Phytolacca americana Lectin sensitizes B cells to Toll-like receptor stimulation, enabling their activation by immunostimulatory DNA. When used in combination with copurified microbial Toll-like receptor ligands, Phytolacca americana Lectin triggers B cell proliferation and immunoglobulin secretion.
Biochemical Assay Reagents   Mitosis   Toll-like Receptor (TLR)   Interleukin Related  
Inflammation or Immune System Disease  
/
HY-W721517 Gabapentin-d10
Gabapentin-d10 is the deuterium labeled Gabapentin (HY-A0057). Gabapentin is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain.
Isotope-Labeled Compounds   Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-P3445 Anrikefon
Anrikefon is a peripherally restricted kappa opioid receptor (KOR) agonist, with an IC50 of 0.54 nM, an EC50 of 2.41 pM, and a Ka of 0.068 nM against human KOR, and it exhibits high selectivity over μ and δ opioid receptors. Anrikefon exerts analgesic effects by inhibiting behaviors associated with inflammatory, postoperative and neuropathic pain, and also exerts antipruritic effects by reducing itch-related behaviors. Anrikefon can be used in research on pain, pruritus, and pruritus associated with chronic kidney disease.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-N2573 Corydalmine
Corydalmine (L-Corydalmine) inhibits spore germination of some plant pathogenic as well as saprophytic fungi. Corydalmine acts as an oral analgesic agent, exhibiting potent analgesic activity. Corydalmine alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway.
Fungal   CXCR  
Infection   Neurological, Eye or Ear Disease  
/
HY-P10519 Brevicidine
Brevicidine is an antimicrobial peptide with selective bactericidal activity against Gram-negative pathogens. Brevicidine disrupts bacterial morphology by binding to lipopolysaccharide (LPS) on the bacterial cell membrane to form pores. Brevicidine causes dissipation of intracellular proton motive force, outer membrane damage, inhibition of ATP biosynthesis and reactive oxygen species accumulation in bacterial cells. As a sensitizer, Brevicidine exerts synergistic activity when combined with a variety of conventional antibiotics.
Bacterial   Reactive Oxygen Species (ROS)  
Bacterial Infection  
/
HY-D1291 Photoacoustic contrast agent-1
Photoacoustic contrast agent-1 (Compound F-1) is a photo/sono-sensitizer that can produce a significant cell killing effect under illuminated conditions. Photoacoustic contrast agent-1 can be used in the research of tumor diagnosis and treatment. Photoacoustic contrast agent-1 is a multifunctional dye. Dyes are important tools in biological experiments. They can help researchers observe and analyze cell structures, track biomolecules, evaluate cell functions, distinguish cell types, detect biomolecules, study tissue pathology and monitor microorganisms. Their applications range from basic scientific research to clinical A wide range of diagnostics. Dyes are also widely used in traditional fields such as textile dyeing, as well as in emerging fields such as functional textile processing, food pigments and dye-sensitized solar cells.
Fluorescent Dye  
/
HY-16900G Rolipram (GMP)
Rolipram GMP is Rolipram (HY-16900) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Rolipram is a PDE4 inhibitor, with blood-brain barrier permeability, that reverses β-amyloid-induced learning and memory impairment in rats. Rolipram elevates intracellular cAMP and clevels and regulates the cAMP/CREB signaling pathway, thereby alleviating neuroinflammation and apoptotic responses. Rolipram promotes neuronal differentiation of human bone marrow mesenchymal stem cells and inhibits Methamphetamine- and morphine-induced hyperlocomotion in mice. Rolipram also reduces the viability of glioblastoma stem-like cells and enhances Bevacizumab (HY-P9906)-induced cell death. Rolipram inhibits the expression of proinflammatory cytokines and enhances central noradrenergic transmission. Rolipram is mainly used in studies related to various central nervous system diseases including Alzheimer's disease, major depressive disorder, glioblastoma multiforme, and multiple sclerosis.
Phosphodiesterase (PDE)   Epigenetic Reader Domain   Amyloid-β  
Depression   Glioblastoma Multiforme   Alzheimer's Disease   Multiple Sclerosis  
/
HY-B0161ES (±)-Duloxetine-d3 hydrochloride
(±)-Duloxetine-d3 (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research.
Isotope-Labeled Compounds   Serotonin Transporter  
Neurological, Eye or Ear Disease  
/
HY-N7147 Irisquinone
Irisquinone, a natural product, is an anticancer agent. Irisquinone is also a radiation sensitizer for cancer. Irisquinone reduces GSH level and inhibits the repair of DNA singular strand breaks.
Others  
Cancer  
/
HY-D0006A Bathophenanthroline disulfonic acid sodium
Bathophenanthroline disulfonic acid sodium is a multifunctional dye. Dyes are important tools in biological experiments. They can help researchers observe and analyze cell structures, track biomolecules, evaluate cell functions, distinguish cell types, detect biomolecules, study tissue pathology and monitor microorganisms. Their applications range from basic scientific research to clinical A wide range of diagnostics. Dyes are also widely used in traditional fields such as textile dyeing, as well as in emerging fields such as functional textile processing, food pigments and dye-sensitized solar cells.
Fluorescent Dye  
/
HY-W777281 Fluocinolone acetonide-13C3
Fluocinolone acetonide-13C3 is the 13C-labeled Fluocinolone (Acetonide) (HY-B0415). Fluocinolone is a glucocorticoid glucocorticoid receptor agonist. Fluocinolone is effective in preventing both lipid accumulation and inflammation. Fluocinolone can promote the proliferation of DPCs and has the potential role in repairing injured pulp tissues. Fluocinolone can be used to study the prevention of chemotherapy-induced peripheral neuropathy caused by Paclitaxel (HY-B0015).
Isotope-Labeled Compounds   Wnt   Glucocorticoid Receptor  
Metabolic or Endocrine Disease  
/
HY-N3887 Evoxine
Evoxine (Haplophytin B) is a compound that selectively inhibits CO2-induced immunosuppression and has activity in inhibiting the expression of interleukin-6 and chemokine CCL2 in human THP-1 macrophages. Evoxine shows antimicrobial activity against a wide range of bacteria, especially performing well in minimum inhibitory concentration (MIC) tests against Escherichia coli, Bacillus subtilis, and Staphylococcus aureus. Evoxine extracts may find application in crude drug preparations in West Africa, provided that their in vivo toxicity results are negative.
Bacterial  
Infection  
/
HY-P992012 CA1001
CA1001 is a small-molecule ZNF74 inhibitor and a peripherally restricted κ/δ dual opioid receptor agonist. CA1001 exhibits potent antitumor activity both in vitro and in vivo. CA1001, in combination with immune checkpoint inhibitors, significantly enhances tumor regression. CA1001 activates peripherally restricted κ/δ dual opioid receptors and exerts analgesic effects under conditions of inflammatory pain, neuropathic pain, and mechanical hyperalgesia. CA1001 can be used in research related to melanoma, mechanical hyperalgesia, neuropathic pain, and inflammatory arthritis pain.

Species: Human

Opioid Receptor  
Melanoma   Pain  
/
HY-N13251 Verbena Extract
Verbena Extract is a verbena extract. Verbena Extract is a potential anti-ischemic stroke agent, and its mechanism may be related to IL17A-mediated neuroinflammation regulation..
Others  
Neurological, Eye or Ear Disease  
/
HY-P1129 AR-M1896
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain.
Neuropeptide Y Receptor  
Neurological, Eye or Ear Disease  
/
HY-P10767 MD01-67
MD01-67 is a selective macrocyclic compound targeting the neurotensin receptor type 2 (NTS2), with Ki of 2.9 nM. MD01-67 exhibits analgesic and tactile hypersensitivity reducing activity in rats acute/persistent/chronic inflammatory pain models.
Neurotensin Receptor  
Neurological, Eye or Ear Disease  
/
HY-16525 XEN-2174
XEN-2174 is a noradrenaline transporter (NET) inhibitor. XEN-2174 inhibits the reuptake of noradrenaline through non-competitive inhibition, increasing the concentration of noradrenaline in the synaptic cleft, thereby activating α2-adrenergic receptor at the spinal level and exerting analgesic effects. XEN-2174 exhibits long-lasting analgesic effects in models of neuropathic pain and postoperative pain in rats. XEN-2174 can be used in pain research.
Monoamine Transporter   Adrenergic Receptor  
Neurological, Eye or Ear Disease  
/
HY-161491 1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid-linker/OVA
1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid-linker/OVA is a multifunctional dye. Dyes are important tools in biological experiments. They can help researchers observe and analyze cell structures, track biomolecules, evaluate cell functions, distinguish cell types, detect biomolecules, study tissue pathology and monitor microorganisms. Their applications range from basic scientific research to clinical A wide range of diagnostics. Dyes are also widely used in traditional fields such as textile dyeing, as well as in emerging fields such as functional textile processing, food pigments and dye-sensitized solar cells.
Fluorescent Dye  
/
HY-P1185A Antagonist G TFA
Antagonist G TFA is a potent vasopressin antagonist. Antagonist G is also a weak antagonist of GRP and Bradykinin. Antagonist G induces AP-1 transcription and sensitizes cells to chemotherapy.
Vasopressin Receptor   Apoptosis  
/
HY-P992401 M802
M802 is an anti-HER2/CD3 bispecific antibody, with a Kd of 0.578 nM for human HER2 and a Kd of 71.2 nM for human CD3. M802 inhibits the PI3K/AKT and MAPK signaling pathways, suppresses tumor cell proliferation, activates caspase-3, and promotes tumor cell apoptosis (apoptosis). M802 recruits and activates CD3-positive immune cells, mediates cytotoxicity against HER2-positive tumor cells, and induces immune cells to secrete IFN-γ, TNF-α, IL-2 and IL-6. M802 exhibits anti-tumor efficacy in mice with gastric cancer xenografts. M802 can be used in research related to HER2-positive breast cancer, HER2-positive gastric cancer and other cancers. The recommended isotype control is human IgG1 kappa (HY-P99001).

Species: Human

EGFR   CD3   PI3K   Akt   p38 MAPK   Caspase   Apoptosis   IFNAR   TNF Receptor   Interleukin Related  
Breast Cancer   Gastric Cancer  
/
HY-W040430A (S)-Nornicotine hydrochloride
(S)-Nornicotine hydrochloride is a nicotine metabolite that crosses the blood-brain barrier. (S)-Nornicotine hydrochloride weakly inhibits human CYP2A6 with a Ki >300 μM. (S)-Nornicotine hydrochloride promotes dopamine release in rat striatal and nucleus accumbens slices and increases endogenous DOPAC overflow through a calcium-dependent nAChR pathway that is sensitive to Mecamylamine (HY-B1395A). (S)-Nornicotine hydrochloride reduces behavioral responses maintained by nicotine or sucrose, exerts analgesic effects in persistent inflammatory pain and neuropathic pain models, and enhances the analgesic effect of morphine. (S)-Nornicotine hydrochloride is useful for research on tobacco dependence and pain.
Drug Metabolite   Cytochrome P450   nAChR  
Pain  
/
HY-P5811 Ceratotoxin-1
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-B0093AS Benazepril-d5 hydrochloride
Benazepril-d5 hydrochloride is deuterium labeled Benazepril hydrochloride. Benazepril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor to reduce angiotensin-II production. Benazepril hydrochloride inhibits oxidative stress and inhibits apoptosis by the PI3K/Akt signaling pathway. In addition, Benazepril hydrochloride improves diabetic nephropathy and decreases proteinuria. Benazepril hydrochloride can be used in the study of hypertension, heart failure and diabetic nephropathy.
Isotope-Labeled Compounds   Angiotensin-converting Enzyme (ACE)   Apoptosis   Reactive Oxygen Species (ROS)   Akt  
Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease   Metabolic or Endocrine Disease  
/
HY-137989S Voriconazole N-oxide-d3
Voriconazole N-oxide-d3 (Voriconazole oxynitride-d3) is deuterium labeled Voriconazole N-oxide. Voriconazole N-oxide (Voriconazole oxynitride) is a potent antifungal agent. Voriconazole N-oxide has phototoxicity and photocarcinogenicity. Voriconazole N-oxide does not sensitize keratinocytes to ultraviolet B (UVB).
Isotope-Labeled Compounds   Fungal  
Infection  
/
HY-W050088S Isoxepac-d6
Isoxepac-d6 (HP 549-d6) is the deuterium labeled Isoxepac (HY-W050088). Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases.
Isotope-Labeled Compounds   Drug Derivative  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P11311 NC-002
NC-002, a cell-permeable peptide, is a Trypsin-like proteasome inhibitor without inhibition of lysosomal cysteine proteases. NC-002 is the epoxyketone derivative of Leupeptin (HY-18234). NC-002 sensitizes myeloma cells to Bortezomib (HY-10227) and Carfilzomib (HY-10455). NC-002 can be used for cancers research.
Proteasome  
Cancer  
/
HY-P10212 AVLX-125
AVLX-125 (UCCB01-125) is a PSD-95 and PDZ domain inhibitor with Kd value of 10 nM. AVLX-125 can be used in the study of inflammatory pain.
iGluR  
Neurological, Eye or Ear Disease  
/
HY-B1888AS Bromfenac-d4 sodium
Bromfenac-d4 (sodium) is deuterium labeled Bromfenac (sodium). Bromfenac sodium is a potent and orally active inhibitor of COX, with IC50s of 5.56 and 7.45 nM for COX-1 and COX-2, respectively. Bromfenac sodium is a brominated non-steroidal anti-inflammatory/analgesic agent (NSAID), and it is commonly used for the research of postoperative inflammation and pain following cataract surgery, and pseudophakic cystoid macular edema (CME).
Isotope-Labeled Compounds   COX  
Inflammation or Immune System Disease  
/
HY-P991384 DX-2240
DX-2240 is a human monoclonal antibody (mAb) targeting TIE1. DX-2240 inhibits tumor growth and sensitizes tumor vasculature to anti-angiogenic agents (VEGF pathway inhibitors).

Species: Human

Tie  
Cancer  
/
HY-155236 Ancistrotecine B
Ancistrotecine B (Compound 2) is a Nav1.7 channel inhibitor (IC50: 0.73 μM). Ancistrotecine B relieves inflammatory pain in mice.
Sodium Channel  
Inflammation or Immune System Disease  
/
HY-137988 Palvanil
Palvanil is a Capsaicin (HY-10448) analogue, shows strong desensitizing capability against the TRPV1 receptor. Palvanil shows anti-nociceptive and anti-inflammation effects.
TRP Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-135746S OR-1896-d3
OR-1896-d3 is the deuterium labeled OR-1896 (HY-135746). OR-1896 is an active long-lived metabolite of Levosimendan. OR-1896 is a highly selective phosphodiesterase (PDE) III isoform inhibitor and a powerful vasodilator. OR-1896 can open ATP-sensitive K+ channels and has Ca2+-sensitizing effect. OR-1896 mitigates cardiomyocyte apoptosis, cardiac remodeling and myocardial inflammation.
Isotope-Labeled Compounds   Potassium Channel   Apoptosis   Phosphodiesterase (PDE)   Drug Metabolite  
/
HY-N0361S Dihydrocapsaicin-d3
Dihydrocapsaicin-d3 is the deuterium labeled Dihydrocapsaicin (HY-N0361). Dihydrocapsaicin, a capsaicin, is a potent and selective TRPV1 (transient receptor potential vanilloid channel 1) agonist. Dihydrocapsaicin reduces AIF, Bax, and Caspase-3 expressions, and increased Bcl-2, Bcl-xL and p-Akt levels. Dihydrocapsaicin enhances the hypothermia-induced neuroprotection following ischemic stroke via PI3K/Akt regulation in rat.
Isotope-Labeled Compounds   Reactive Oxygen Species (ROS)   PI3K   Bcl-2 Family   Caspase   Apoptosis   TRP Channel   Akt  
/
HY-N21629 Phanginin J
Phanginin J is a Cassane-type furanoditerpene found in the seeds of Caesalpinia sappan L. Phanginin J docks with the TRPV1 molecule and may inhibit nociceptive sensory signal transduction by antagonizing TRPV1. Phanginin J can be used in research related to chemotherapy-induced peripheral neuropathy (CIPN).
Drug Derivative   TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-15244G Alpelisib (GMP)
Alpelisib GMP is Alpelisib (HY-15244) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Alpelisib (BYL-719) is an orally active PI3Kα-selective inhibitor that blocks the conversion of PIP2 to PIP3, thereby inhibiting pathways including PI3K/AKT/mTOR, MAPK/ERK, Notch and JAK-STAT. Alpelisib also induces apoptosis, G0/G1 phase arrest and senescence; it significantly inhibits the proliferation, self-renewal, stemness and epithelial-mesenchymal transition (EMT) of tumor cells, reduces cancer stem cell populations and decreases the expression of stem cell markers. Alpelisib not only enhances the sensitivity to Eribulin (HY-13442) and exerts a synergistic effect with Paclitaxel (HY-B0015), but may also induce drug resistance by upregulating the SGK3/GSK3β/β-catenin signaling pathway. Alpelisib can be applied to research related to breast cancer, gastric cancer and lipomas associated with PTEN hamartoma tumor syndrome.
PI3K   Apoptosis  
/
HY-178304S L-Valine-d7
L-Valine-d7 is the deuterium labeled L-Valine (HY-N0717). L-Valine ((S)-Valine) is a nonlinear semiorganic material. L-Valine causes lipid peroxidation and accumulation of malondialdehyde (MDA), exhibits inhibitory activity against cyanobacteria. L-Valine inhibits multidrug-resistant bacteria through activation of PI3K/Akt signaling pathway and inhibition of arginase.
Isotope-Labeled Compounds   Akt   Arginase   Bacterial  
Infection  
/
HY-P5916 VSTx-3
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
Others   Potassium Channel  
Neurological, Eye or Ear Disease  
/
HY-P10654 RhTx
RhTx is a transient receptor potential vanillin-1 (TRPV1) activator. RhTx can be used to study pain perception.
TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-Y0788R Indoline (Standard)
Indoline (Standard) is an analytical standard for Indoline (HY-Y0788). This product is intended for research and analytical applications. Indoline is a HIV-1 envelope glycoprotein gp120 binder. Indoline binds to the conserved CD4-binding site of gp120 (the Phe 43 cavity and its surrounding vestibule), competitively blocks the binding of CD4, and prematurely triggers conformational changes of the Env trimer, resulting in viral inactivation. Indoline induces the conformational opening of HIV-1 Env on infected cells, exposes vulnerable epitopes, increases antibody recognition rate, enhances the binding of FcγRIIIa receptors, and sensitizes infected cells to antibody-dependent cellular cytotoxicity. Indoline is a derivative of Indole (HY-W001132). Indoline can be used in studies related to HIV-1 infection.
Reference Standards   HIV  
Infection  
/
HY-17355BS Dexpramipexole-d3 dihydrochloride
Dexpramipexole-d3 ((R)-Pramipexole-d3) dihydrochloride is the deuterium labeled Dexpramipexole. Dexpramipexole ((R)-Pramipexole) dihydrochloride is an orally active, blood-brain barrier permeable mitochondrial protective agent. Dexpramipexole dihydrochloride upregulates the expression of Parkin, PINK1, GPX4 and FSP1; binds to mitochondrial F1/Fo-ATP synthase; blocks the Nav1.8 sodium channel; and inhibits the activation of the NLRP3 inflammasome. Dexpramipexole dihydrochloride induces mitophagy, inhibits ferroptosis, pyroptosis, apoptosis, neuroinflammation and eosinophilopoiesis; maintains mitochondrial function and redox homeostasis; reduces reactive oxygen species production; and decreases myocardial infarct size. Dexpramipexole dihydrochloride is applicable to studies on eosinophilic asthma, myocardial ischemia/reperfusion injury, sepsis-associated encephalopathy, analgesia, and more.
Reactive Oxygen Species (ROS)   Isotope-Labeled Compounds   Glutathione Peroxidase   Ferroptosis   Apoptosis   Sodium Channel   Mitophagy   Autophagy   ATP Synthase   NOD-like Receptor (NLR)   PINK1/Parkin  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-17474S1 Parecoxib-d5
Parecoxib-d5 (SC 69124-d5) is deuterium labeled Parecoxib. Parecoxib (SC 69124) is a highly selective and orally active COX-2 inhibitor, the proagent of Valdecoxib (HY-15762). Parecoxib Sodium is a nonsteroidal anti-inflammatory agent (NSAID) and inhibits prostaglandin (PG) synthesis. Parecoxib can be used for the relief of acute postoperative pain and symptoms of chronic inflammatory conditions such as osteoarthritis and rheumatoid arthritis in vivo.
Isotope-Labeled Compounds   COX  
Cancer   Inflammation or Immune System Disease  
/
HY-B0130AS Perindopril-d3 erbumine
Perindopril-d3 (erbumine) is deuterated labeled Perindopril (erbumine) (HY-B0130A). Perindopril erbumine is an angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NF-κB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure.
NF-κB   Angiotensin-converting Enzyme (ACE)   Sirtuin   STAT   Isotope-Labeled Compounds  
Cancer   Blood or Cardio-cerebrovascular Disease  
/
HY-P10358A TAT-CBD3A6K acetate
TAT-CBD3A6K acetate, is a modified TAT-CBD3 peptide. TAT-CBD3A6K acetate reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K acetate shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function.
Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-D3598 CCR2 ligand-2
CCR2 ligand-2 is a small-molecule fluorescent ligand targeting the intracellular allosteric binding site (IABS) of CCR2, with a Kd value of 266 nM for membrane-based binding affinity and a Kd value of 114 nM for binding affinity in live cells. CCR2 ligand-2 enables non-isotopic, high-throughput cell-free and cell-based NanoBRET binding assays. CCR2 ligand-2 serves as a tool for fragment-based screening strategies.
CCR  
/
HY-P3071 ShK toxin
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation.
Potassium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-W141871 DL-Thyronine
DL-Thyronine protects trypsin from photodynamic inactivation sensitized by Riboflavin-5'-phosphate (FMN).
Biochemical Assay Reagents  
/
HY-P1624S Teduglutide-Ala(13C3,15N) sodium
Teduglutide-Ala(13C3,15N) (ALX-0600-Ala(13C3,15N)) sodium is the 13C- and 15N-labeled Teduglutide (HY-P1624). Teduglutide (ALX-0600) is an analog of human glucagon like peptide-2 (GLP-2). Teduglutide can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
Isotope-Labeled Compounds   FXR   Nuclear Hormone Receptor 4A/NR4A  
/
HY-13762S Tesmilifene-d4
Tesmilifene-d4 is the deuterium labeled Tesmilifene (HY-13762). Tesmilifene is an antihistamine agent and a chemical sensitizer. Tesmilifene targets cytochrome P450, exhibits hormonal effects on DNA synthesis in MCF-7 cells, and stimulates the tumor growth in mouse/rat models. Tesmilifene overcomes multidrug resistance.
Isotope-Labeled Compounds   Cytochrome P450  
/
HY-119521S Mexiletine-d3
Mexiletine-d3 (KOE-1173-d3) is deuterium labeled Mexiletine. Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research.
Isotope-Labeled Compounds  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-P2027 B 4310
B 4310 is a non-organ-selective Bradykinin antagonist. B 4310 induces uterine contraction in rats. B 4310 blocks bradykinin-mediated responses, including substance P release, plasma extravasation, venous contraction, prostaglandin E2 release and trigeminal nerve stimulation, but exerts no effect on angiotensin II, acetylcholine or capsaicin pathways. B 4310 exerts a reversible antagonistic effect on bradykinin-induced nociceptors. B 4310 serves as a tool for investigating the biological effects of bradykinin.
Bradykinin Receptor  
Female Reproductive System Disease   Hypotension  
/
HY-18732AR L-NMMA acetate (Standard)
L-NMMA (Tilarginine) acetate (Standard) is the analytical standard of L-NMMA acetate (HY-18732A). This product is intended for research and analytical applications. L-NMMA (Tilarginine) acetate is a non-selective and competitive inhibitor of nitric oxide synthase. L-NMMA acetate inhibits three subtypes, namely nNOS, eNOS, and iNOS, and reduces NO production. L-NMMA acetate alleviates mechanical allodynia, thermal hyperalgesia, and choroidal fibrosis. L-NMMA acetate is applicable to research related to nociception, bone cancer pain, and myopia.
Reference Standards   NO Synthase  
Cancer   Blood or Cardio-cerebrovascular Disease  
/
HY-N15176 Bisucaberin
Bisucaberin is a natural siderophore, is a DNA synthesis inhibitor. Bisucaberin shows cytostasis for tumor cells. Bisucaberin sensitizes tumor cells to macrophage-mediated cytolysis.

Source: Alteromonas haloplanktis Strain SB-1123

DNA/RNA Synthesis  
/
HY-135164 Lonchocarpic acid
Lonchocarpic acid has an anti-inflammatory mechanism of lonchocarpine in LPS- or poly(I:C)-induced neuroinflammation.
Insecticide  
Inflammation or Immune System Disease  
/
HY-P991745 Anti-Mouse CCR2 Antibody (C2Mab-6)
Anti-Mouse CCR2 Antibody (C2Mab-6) is a monoclonal antibody targeting mouse CC chemokine receptor type 2 (mCCR2), with a KD value of 0.18-1.6 nM. Anti-Mouse CCR2 Antibody (C2Mab-6) exhibits high binding affinity to cells expressing mCCR2 and shows no reactivity to parental CHO-K1 cells. Anti-Mouse CCR2 Antibody (C2Mab-6) recognizes the amino acid region spanning positions 1-19 of mCCR2, and its key binding epitope includes Asp3, Asn4, Met6, Pro8, Gln9 and Phe10. Anti-Mouse CCR2 Antibody (C2Mab-6) can be used in leukemia-related research.

Species: Mouse

CCR  
Leukemia/Lymphoma/Myeloma  
/
HY-W009688R Dibutyl maleate (Standard)
Dibutyl maleate (Standard) is the analytical standard of Dibutyl maleate (HY-W009688). This product is intended for research and analytical applications. Dibutyl maleate, the diester of the Maleic Acid, can be used as an intermediate of pharmaceutical synthesis. Dibutyl maleate can enhance contact sensitization to Fluorescein isothiocyanate in mice.
Drug Intermediate   Reference Standards  
/
HY-119521S1 Mexiletine-d6
Mexiletine-d6 (KOE-1173-d6) is deuterium labeled Mexiletine. Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research.
Isotope-Labeled Compounds   Sodium Channel  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-16935S Mavatrep-d6
Mavatrep-d6 (JNJ-39439335-d6) is a deuterated labeled Mavatrep (HY-16935). Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (Ki=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca2+ influx with an IC50 value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain.
Isotope-Labeled Compounds   TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-101546A Cavidine
Cavidine ((+)-Cavidine) is an analgesic and anti-inflammatory agent. Cavidine can be isolated from Corydalis ternata f. yanhusuo (Y.H.Chou & Chun C.Hsu) Y.C.Zhu. Cavidine reduces the expression of inflammatory factors IL-1β, IL-6 and TNF-α, and inhibits calcium ion influx. Cavidine inhibits the phosphorylation of p38 and ERK1/2. Cavidine increases mechanical and thermal pain thresholds in chronic pain models. Cavidine can be used for the research of chronic pain.
p38 MAPK   ERK   Interleukin Related  
Inflammation or Immune System Disease   Chronic Pain  
/
HY-P10393 ERα17p
ERα17p (ERα 295-311) is the epitope of the CaM binding site on the estrogen receptor α (ER), which interacts with calmodulin (CaM) in a calcium-dependent manner. ERα17p regulates the migration of cancer cells MCF-7, SK-BR-3, T47D, and MDA-MB-231 through Rho/ROCK and PI3K/Akt signaling pathways. ERα17p inhibits proliferations of breast cancer cells, induces apoptosis, and inhibits tumor growth in mouse models.
Apoptosis  
/
HY-122607S DPA-714-d10
DPA-714-d10 is the deuterium labeled DPA-714 (HY-122607). DPA-714 is a high affinity translocator protein (TSPO) ligand (Ki=7 nM), which is designed with a fluorine atom in its structure, allowing labelling with fluorine -18 and in vivo imaging using positron emission tomography. 18FDPA-714 successfully evaluates for the specific imaging of inflammation in various models of neuroinflammation and in a brain tumor model.
Isotope-Labeled Compounds   TSPO   Mitochondrial Metabolism  
Cancer   Inflammation or Immune System Disease  
/
HY-W025736 5-Amino-2-methoxyphenol
5-Amino-2-methoxyphenol is a phenolic regioisomer. 5-Amino-2-methoxyphenol produces dose-dependent antinociception in the mouse formalin test, with its second-phase effect being mechanistically dependent on both FAAH and TRPV1. 5-Amino-2-methoxyphenol can be used for antinociception research.
Drug Isomer  
Inflammation or Immune System Disease   Pain  
/
HY-N1884 4',​7-​Di-​O-​methylnaringenin
4',​7-​Di-​O-​methylnaringenin ((−)-NRG-DM) is a flavonoid found in Renealmia alpinia. (−)-NRG-DM inhibits Nav1.7, Nav1.8 and Kv2.1 channels and has analgesic activity. Intraperitoneal administration of (−)-NRG-DM dose-dependently attenuated pain in a formalin-induced mouse inflammatory pain model and mustard oil-induced mouse colorectal pain model[2].
Sodium Channel   Potassium Channel  
/
HY-P5773 Jingzhaotoxin-34
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-P3223A Biphalin acetate
Biphalin acetate, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores.Biphalin acetate has high affinity for opioid receptors. Biphalin acetate shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin acetate is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent.
Opioid Receptor  
Neurological, Eye or Ear Disease  
/
HY-N7536 Voacangine
Voacangine is an antagonist for TRPV1 and TRPM8 but as an agonist for TRPA1 (EC50=8 μM). Voacangine competitively blockes capsaicin binding to TRPV1 (IC50=50 μM). Voacangine competitively inhibits the binding of menthol to TRPM8 (IC50=9 μM) and it shows noncompetitive inhibition against icilin (IC50=7 μM). Voacangine selectively abrogates chemical agonist-induced TRPM8 activation and did not affect cold-induced activation. Voacangine is an alkaloid isolated from the root bark of Voacanga africana.
TRP Channel  
/
HY-P1175 L-R4W2
L-R4W2 is a potent antagonist of vanilloid receptor 1 (VR1, TRPV1), with an IC50 of 0.1 μM. L-R4W2 may act as a potent analgesic.
TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-P991622 MNAC13
MNAC13 is a kind of mouse IgG1 chimeric antibody, targeting to human TrkA. MNAC13 inhibits the NGF dependent signaling pathway by specifically binding to TrkA receptors. MNAC13 has good analgesic effect and long-lasting efficacy. MNAC13 can be used for researches on inflammatory and chronic pain.

Species: Human

Trk Receptor  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-145491 Resolvin D5
Resolvin D5 is an anti-inflammatory and analgesic agent produced in M2 macrophages. Resolvin D5 alleviates Paclitaxel (HY-B0015)-induced mechanical allodynia and inflammatory pain by activating the GPR32 receptor, with gender specificity (effective only in male mice) and independence from TRPV1 or TRPA1 channels. Resolvin D5 attenuates LPS-induced ERK phosphorylation and NF-κB nuclear translocation, downregulates proinflammatory mediators such as IL-6 and CCL5, inhibits Th17 cell differentiation and osteoclastogenesis, promotes regulatory T cell differentiation, and shows no cytotoxicity to human monocytes. The level of Resolvin D5 is elevated in arthritic SKG mice, but Resolvin D5 has no effect on dendritic cell differentiation or M1 macrophage polarization, nor does it prevent ZyA-induced arthritis progression. Resolvin D5 is suitable for research related to chemotherapy-induced peripheral neuropathy, inflammatory pain and rheumatoid arthritis.
ERK   NF-κB   CCR  
Rheumatoid Arthritis  
/
HY-P1346 APETx2
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.

Source: Anthopleura elegantissima

Sodium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-N3710 Dehydrocrenatidine
Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain.
JAK   Apoptosis  
Cancer   Neurological, Eye or Ear Disease  
/
HY-W747676 Glyphosate-13C
Glyphosate-13C is the 13C-labeled Glyphosate (HY-B0863). Glyphosate, a non-selective systemic biocide with broad-spectrum activity, is an herbicidal derivative of the amino acid glycine. Glyphosate inhibits the enzymatic activity of the 5-endopyruvylshikimate 3-phosphate synthase (EPSPS) in the shikimic acid pathway, preventing the synthesis of the aromatic amino acids tyrosine, phenylalanine, and tryptophan. Glyphosate induces oxidative stress, neuroinflammation, and mitochondrial dysfunction, processes that lead to neuronal death by autophagia, necrosis, or apoptosis, as well as the appearance of behavioral and motor disorders.
Isotope-Labeled Compounds   Necroptosis   Autophagy   Apoptosis  
Neurological, Eye or Ear Disease  
/
HY-P11553A ECL1i TFA
ECL1i TFA is an allosteric, selective CCR2 inhibitor. ECL1i TFA specifically inhibits CCL2-/CCR2-mediated chemotaxis. ECL1i TFA interferes with CCR2-positive cell recruitment and attenuates disease progression in experimental autoimmune encephalomyelitis.
CCR  
Inflammation or Immune System Disease   Experimental Autoimmune Encephalomyelitis  
/
HY-124073 Dihydrocapsiate
Dihydrocapsiate, as a compound of capsinoid family, is an orally active TRPV1 agonist. Dihydrocapsiate can be used for the research of metabolism disease.
TRP Channel  
Metabolic or Endocrine Disease   Pain  
/
HY-P991711 Povovetug
Povovetug is a humanized IgG1κ chimeric monoclonal antibody inhibitor targeting NGF/bNGF. Povovetug has a significant analgesic activity. Povovetug can be used for central neuroinflammation like chronic radicular pain research.

Species: Human

Trk Receptor  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-N0728S2 α-Linolenic acid-d14
α-Linolenic acid-d14 is the deuterium labeled α-Linolenic acid. α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
Isotope-Labeled Compounds   PI3K   Akt  
Cancer   Blood or Cardio-cerebrovascular Disease  
/
HY-108449S Acoltremon-d3
Acoltremon-d3 (WS-12-d3) is the deuterium labeled Acoltremon (HY-108449). Acoltremon is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research.
Isotope-Labeled Compounds   TRP Channel  
Neurological, Eye or Ear Disease  
/
HY-139201H Poly-D-lysine hydrobromide (MW ≥300000)
Poly-D-lysine hydrobromide (MW ≥300000) (PDLHB (MW ≥300000)) is a cationic polymer and cell adhesion promoter. Poly-D-lysine hydrobromide (MW ≥300000) serves as a substrate coating to support the adhesion and proliferation of rat dorsal root ganglion satellite glial cells in vitro. Poly-D-lysine hydrobromide (MW ≥300000) promotes the adhesion and immobilization of cells on plastic culture dishes. Poly-D-lysine hydrobromide is also known as a calcium-sensing receptor (CaSR) agonist peptide.
CaSR  
/
HY-P5786 Heteropodatoxin-1
Heteropodatoxin-1 (HpTx1), a spider peptide toxin, is a Kv4.2 current inhibitor. Heteropodatoxin-1 also inhibits Nav1.7 and activates Nav1.9 but does not affect Nav1.8.
Potassium Channel   Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-B0464S Hydralazine-d4 hydrochloride
Hydralazine-d4 hydrochloride is the deuterium labeled Hydralazine hydrochloride. Hydralazine hydrochloride is an orally active, blood-brain barrier-permeable DNA methyltransferase inhibitor with vasodilatory, arterial smooth muscle relaxant and hypotensive activities. Hydralazine hydrochloride reactivates silenced tumor suppressor genes via mediating DNA demethylation, while exerting neuroprotective and anti-inflammatory properties. Hydralazine hydrochloride inhibits NOS-2 (iNOS) and COX-2, and reduces the production of NO and PGEE2; meanwhile, Hydralazine hydrochloride scavenges reactive oxygen species and inhibits macrophage activation. Hydralazine hydrochloride alleviates motor dysfunction, neuropathic inflammatory pain, and formalin-induced somatic and emotional pain responses. In addition, Hydralazine hydrochloride directly induces DNA strand breaks and sister chromatid exchange, exhibiting certain mutagenic characteristics. Hydralazine hydrochloride has been widely used in studies on hypertension, various cancers (such as cervical cancer, leukemia), spinal cord injury and the mechanisms of inflammatory pain.
Isotope-Labeled Compounds   PGE synthase   NO Synthase   Reactive Oxygen Species (ROS)   DNA Methyltransferase   COX  
Blood or Cardio-cerebrovascular Disease  
/
HY-P10358 TAT-CBD3A6K
TAT-CBD3A6K, is a modified TAT-CBD3 peptide. TAT-CBD3A6K reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function.
Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-P992120 Minokitug
Minokitug is a humanized monoclonal antibody targeting the CCR2 protein. Minokitug can be used for the research of refractory/relapsed ulcerative colitis.

Species: Human

CCR  
Ulcerative Colitis  
/
HY-P991641 IMC-EB10
IMC-EB10 (LY3012218) is an anti-FLT3 monoclonal antibody. IMC-EB10 binds to FLT3 with high affinity (Kd = 158 pM) and blocks the binding of FLT3 ligand to FLT3 (IC50 ≈ 10 nM), thereby inhibiting MAPK, STAT5, and PI3K/Akt signaling in leukemia cells. IMC-EB10 can enhance the anti-leukemic effect of Methotrexate (HY-14519) and inhibit leukemias expressing wild-type or ITD-mutated FLT3 receptors. IMC-EB10 prolongs the survival of acute lymphoblastic leukemia (ALL) cells and primary leukemia samples and reduces engraftment in non-obese diabetic/severe combined immunodeficiency patients. IMC-EB10 is indicated for leukemia research.

Species: Human

FLT3   p38 MAPK   STAT   PI3K   Akt  
Cancer  
/
HY-P1624S1 Teduglutide-Leu(13C6,15N) sodium
Teduglutide-Leu(13C6,15N) (ALX-0600-Leu(13C6,15N)) sodium is the 13C- and 15N-labeled Teduglutide (HY-P1624). Teduglutide (ALX-0600) is an analog of human glucagon like peptide-2 (GLP-2). Teduglutide can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
Isotope-Labeled Compounds   FXR   Nuclear Hormone Receptor 4A/NR4A  
/
HY-P990610 KHK-2898
KHK-2898 is a monoclonal antibody targeting CD98, which binds to the extracellular domain of CD98 on the tumor cell membrane in a non-covalent antigen-specific mode. KHK-2898 can disrupt the heterodimeric complex formed by CD98 with LAT1 and xCT light chains, reduce the amino acid uptake capacity of tumor cells, block the PI3K/AKT/mTOR proliferative signaling cascade, and mediate antibody-dependent cytotoxicity. KHK-2898 can be used for cancer-related research. The isotype control of KHK-2898 can be found in Human IgG1 kappa, Isotype Control (HY-P99001).

Species: Human

Akt   mTOR   PI3K  
Cancer  
/
HY-34544 2-Hexylthiophene
2-Hexylthiophene is an extremely weak basic heteroaromatic compound. 2-Hexylthiophene can be used to modify and improve the molar absorption coefficient of ruthenium sensitizer
Others  
/
HY-W011038S Hexadecylpyridinium-d5 bromide
Hexadecylpyridinium bromide-d5 (HDPB-d5) is the deuterated form of Hexadecylpyridinium bromide. Hexadecylpyridinium bromide (HDPB) is a cationic surfactant. Hexadecylpyridinium bromide can act as a sensitizer and solubilizer, and is a key component in spectrophotometric determination of metal ion reaction systems. Hexadecylpyridinium bromide can be used as a new passivating ligand for the synthesis and stabilization of cesium lead bromide calcium phosphate nanocrystals.
Isotope-Labeled Compounds   Biochemical Assay Reagents  
/
HY-P11553B DOTA-ECL1i
DOTA-ECL1i is a conjugate of the CCR2 inhibitor ECL1i (HY-P11553) and DOTA. When radiolabeled with 68Ga, DOTA-ECL1i serves as a PET tracer that targets CCR2 expression. DOTA-ECL1i can be used in research related to pulmonary fibrosis, cardiac injury, abdominal aortic aneurysm inflammation, atherosclerosis, head and neck cancer, and pancreatic cancer.
Radionuclide-Drug Conjugates (RDCs)   CCR  
Pancreatic Cancer   Heart Disease   Atherosclerosis and Inflammation   Aortic Aneurysm   Lung Fibrosis  
/
HY-B1804S Tricaprilin-13C3
Tricaprilin-13C3 (Trioctanoin-13C3) is a 13C-labeled Tricaprilin (HY-B1804). Tricaprilin is an orally active and well tolerated ketogenic agent that safely induces ketosis. Tricaprilin restores brain electrical activity and metabolism to help counteract neuroinflammation in migraine. Tricaprilin is promising for research of migraine prevention and Alzheimer’s disease (AD). Tricaprilin is a pure C8 medium chain triglyceride (MCT).
Isotope-Labeled Compounds   Endogenous Metabolite  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-D2337 Quinophthalone
Quinophthalone is a dye with distinctive greenish yellow color. Quinophthalone is used as coloring agents for various materials. Quinophthalone is a strong sensitizer in guinea pigs, and its threshold concentration for induction and challenge is 10 ppm.
Fluorescent Dye  
Inflammation or Immune System Disease  
/
HY-Y0203S 2,4-Dichloropyrimidine-d2
2,4-Dichloropyrimidine-d2 is the deuterium labeled 2,4-Dichloropyrimidine. 2,4-Dichloropyrimidine is a sensitizer.
Isotope-Labeled Compounds  
Inflammation or Immune System Disease  
/
HY-B0464S1 Hydralazine-d5 hydrochloride
Hydralazine-d5 (hydrochloride) is deuterium-labeled Hydralazine (hydrochloride) (HY-B0464). Hydralazine hydrochloride is an orally active, blood-brain barrier-permeable DNA methyltransferase inhibitor with vasodilatory, arterial smooth muscle relaxant and hypotensive activities. Hydralazine hydrochloride reactivates silenced tumor suppressor genes via mediating DNA demethylation, while exerting neuroprotective and anti-inflammatory properties. Hydralazine hydrochloride inhibits NOS-2 (iNOS) and COX-2, and reduces the production of NO and PGEE2; meanwhile, Hydralazine hydrochloride scavenges reactive oxygen species and inhibits macrophage activation. Hydralazine hydrochloride alleviates motor dysfunction, neuropathic inflammatory pain, and formalin-induced somatic and emotional pain responses. In addition, Hydralazine hydrochloride directly induces DNA strand breaks and sister chromatid exchange, exhibiting certain mutagenic characteristics. Hydralazine hydrochloride has been widely used in studies on hypertension, various cancers (such as cervical cancer, leukemia), spinal cord injury and the mechanisms of inflammatory pain.
Isotope-Labeled Compounds   PGE synthase   NO Synthase   Reactive Oxygen Species (ROS)   DNA Methyltransferase   COX  
Cancer  
/
HY-B0965AS Thioridazine-d3 hydrochloride
Thioridazine-d3 (hydrochloride) is the deuterium labeled Thioridazine. Thioridazine, an antagonist of the dopamine receptor D2 family proteins, exhibits potent anti-psychotic and anti-anxiety activities. Thioridazine is also a potent inhibitor of PI3K-Akt-mTOR signaling pathways with anti-angiogenic effect. Thioridazine shows antiproliferative and apoptosis induction effects in various types of cancer cells, with specificity on targeting cancer stem cells (CSCs).
Dopamine Receptor   Apoptosis   5-HT Receptor   Autophagy   Bacterial  
Neurological, Eye or Ear Disease  
/
HY-P10940A Ac-RFAAKAA-COOH TFA
Ac-RFAAKAA-COOH TFA is a heptapeptide with one reactive Lys residue. Ac-RFAAKAA-COOH TFA can be used for detecting skin sensitizing components in cosmetics and other substances.
Others  
/
HY-B0633E Hyaluronic acid, low endotoxin
Hyaluronic acid, low endotoxin (Hyaluronan, low endotoxin) is a biopolymer composed of repeating disaccharide units containing low levels of endotoxin. Hyaluronic acid is a major component of the extracellular matrix (ECM). It is synthesized on the plasma membrane. Hyaluronic acid exerts its effects by binding to receptors CD44 and RHAMM. Hyaluronic acid activates PI3K-Akt signaling. Hyaluronic acid also enhances cell invasion and angiogenesis by promoting or stimulating the binding of proteolytic MMP-9 to the cell surface. Elevated hyaluronic acid levels are associated with tumor cell growth, adhesion, migration, invasion, and angiogenesis in digestive system cancers. Hyaluronic acid is involved in tissue remodeling and rapid cell proliferation in several physiological processes, including embryonic morphogenesis and wound healing. Hyaluronic acid can be used as a regulator of cancer-associated lymphangiogenesis. Hyaluronic acid can be used as a drug delivery carrier for sodium butyrate, enhancing its anti-proliferative activity against breast cancer cell lines. Hyaluronic acid can lubricate the corneal endothelium. Hyaluronic acid can improve tissue hydration and enhance the resistance of cells to mechanical damage. Hyaluronic acid has been conjugated with antibodies to ensure that the active compound continues to exert its effects at the site of inflammation. Hyaluronic acid can be used in research in the fields of osteoarthritis, ophthalmology, cosmetic dermatology, oncology, and liver diseases.
Endogenous Metabolite   CD44   Bacterial   Akt   PI3K  
Cancer   Inflammation or Immune System Disease   Visual System Disease   Liver Disease   Osteoarthritis  
/
HY-B1804S2 Tricaprilin-d15
Tricaprilin-d15 (Trioctanoin-d15) is the deuterium labeled Tricaprilin (HY-B1804). Tricaprilin is an orally active and well tolerated ketogenic agent that safely induces ketosis. Tricaprilin restores brain electrical activity and metabolism to help counteract neuroinflammation in migraine. Tricaprilin is promising for research of migraine prevention and Alzheimer’s disease (AD). Tricaprilin is a pure C8 medium chain triglyceride (MCT).
Isotope-Labeled Compounds   Endogenous Metabolite  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-D1180 DTTCI
DTTCI (3,3′-Diethylthiatricarbocyanine iodide) is an infrared photographic sensitizing dye. DTTCI is a highly sensitive chiroptical reporter of DNA helicity and sequence.
Fluorescent Dye  
/
HY-P6292 KS-133
KS-133 is a bicyclic peptide with VIPR2 antagonistic activity that can cross the blood-brain barrier. KS-133 selectively blocks VIPR2-mediated Gq/Ca, Gs/cAMP, cAMP/PKA/ERK and PI3K/AKT/GSK3β signaling pathways. KS-133 inhibits VIPR2 agonist-induced CREB phosphorylation in the prefrontal cortex of mice. KS-133 shifts the polarization direction of macrophages toward M1. KS-133 attenuates cancer cell proliferation and reduces the cell cycle distribution level at the S-M phase. KS-133 exerts antitumor effects in a mouse model of colorectal cancer. KS-133 reverses cognitive decline in mouse models of psychiatric disorders. KS-133 can be used for research related to schizophrenia, colorectal cancer and breast cancer.
PACAP Receptor   PKA   ERK   PI3K   Akt   GSK-3  
Breast Cancer   Colorectal Cancer   Neurodegenerative Disease   Schizophrenia  
/
HY-W009688 Dibutyl maleate
Dibutyl maleate, the diester of the Maleic Acid, can be used as an intermediate of pharmaceutical synthesis. Dibutyl maleate can enhance contact sensitization to Fluorescein isothiocyanate in mice.
Drug Intermediate  
Inflammation or Immune System Disease  
/
HY-P3071A ShK toxin TFA
ShK toxin TFA (Stichodactyla helianthus neurotoxin TFA) is a neurotoxin. ShK toxin TFA blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin TFA can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin TFA competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin TFA suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin TFA also inhibits T lymphocyte proliferation.
Potassium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-121636S Resolvin D2-d5
Resolvin D2-d5 is the deuterium labeled Resolvin D2. Resolvin D2 is a metabolite of docosahexaenoic acid (DHA), with anti-inflammatory, anti-infective activities. Resolvin D2 is a potent regulator of leukocytes and controls microbial sepsis. Resolvin D2 is a remarkably potent inhibitor of TRPV1 (IC50 = 0.1 nM) and TRPA1 (IC50 = 2 nM) in primary sensory neurons.
TRP Channel  
Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-90006S1 5-Fluorouracil-13C,15N2
5-Fluorouracil-13C,15N2 is the 13C and 15N labeled 5-Fluorouracil. 5-Fluorouracil (5-FU) is an analogue of uracil and a potent antitumor agent. 5-Fluorouracil affects pyrimidine synthesis by inhibiting thymidylate synthetase thus depleting intracellular dTTP pools. 5-Fluorouracil induces apoptosis and can be used as a chemical sensitizer. 5-Fluorouracil also inhibits HIV.
Exosomes   Apoptosis   Nucleoside Antimetabolite/Analog   HIV   Endogenous Metabolite  
Cancer  
/
HY-W008292 Carbostyril 124
Carbostyril 124 is a sensitising chromophore. Carbostyril 124 is a reasonably effective organic sensitizer for a proximate bound terbium ion.
Fluorescent Dye  
/
HY-P1185 Antagonist G
Antagonist G is a potent vasopressin antagonist. Antagonist G is also a weak antagonist of GRP and Bradykinin. Antagonist G induces AP-1 transcription and sensitizes cells to chemotherapy.
Vasopressin Receptor   Apoptosis  
Cancer   Digestive System Disease   Digestive System Inflammation   Hypertension  
/
HY-N7069 4-Isopropylbenzyl alcohol
4-Isopropylbenzyl alcohol (Cuminic alcohol) is an opioid-dependent analgesic. 4-Isopropylbenzyl alcohol activates opioid receptor, regulates the L-Arginine (HY-N0455)/NO/cGMP pathway, and reduces spinal cord TNF-α and IL-1β levels; it binds to BSA (HY-D0842) via static quenching. 4-Isopropylbenzyl alcohol can be used in research related to nociceptive pain, neuropathic pain, bacterial infection and diabetes.
Opioid Receptor   TNF Receptor   Interleukin Related  
Bacterial Infection   Pain   Glucose Metabolism  
/
HY-N0728S α-Linolenic acid-d5
α-Linolenic acid-d5 is the deuterium labeled α-Linolenic acid. α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
Isotope-Labeled Compounds   PI3K   Akt  
Cancer   Blood or Cardio-cerebrovascular Disease  
/
HY-P991208 Flt-3L-Ig (hum/hum)
Flt-3L-Ig (hum/hum) (hFlt3L) is a Flt3 ligand. Flt-3L-Ig (hum/hum) enhances the release of inflammatory cytokines from myeloid cells and dendritic cells in BRGSF-CBC mice induced by OKT3. Flt-3L-Ig (hum/hum) increases the release of IL-2, CCL2 and CXCL10 in an OKT3-dependent manner. Flt-3L-Ig (hum/hum) can be used in studies related to cytokine release syndrome. Flt-3L-Ig (hum/hum) can be used in studies related to psoriasis-like skin inflammation.

Species: Human

FLT3   Interleukin Related   CCR  
Psoriasis  
/
HY-P991174 Anti-TREM2 Antibody (AL2p-58)
Anti-TREM2 Antibody (AL2p-58) is a humanized IgG1 monoclonal antibody targeting TREM2. Anti-TREM2 Antibody (AL2p-58) can be used for the research of neuroinflammation. Recommend Isotype Controls: Human IgG1 kappa, Isotype Control (HY-P99001).

Species: Human

TREM receptor  
Inflammation or Immune System Disease  
/
HY-W010243S Methylisothiazolinone-d3 hydrochloride
Methylisothiazolinone-d3 hydrochloride is the deuterium labeled Methylisothiazolinone hydrochloride (HY-W010243). Methylisothiazolinone hydrochloride is a bacterial and fungal inhibitor and preservative, as well as a sensitizer. Methylisothiazolinone hydrochloride can activate matrix metalloproteinases (MMPs) in human bronchial epithelial cells to induce apoptosis and inflammatory response. Methylisothiazolinone hydrochloride can promote the development of atopic dermatitis in mice by disrupting Th2/Th17 related immune responses. Methylisothiazolinone hydrochloride can cause mitochondrial damage in the endothelium of rat cerebral blood vessels.
Isotope-Labeled Compounds   Bacterial   MMP   Apoptosis   Fungal  
Infection   Inflammation or Immune System Disease  
/
HY-P1346A APETx2 TFA
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.
Sodium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P1091 Hemopressin (human, mouse)
Hemopressin is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin exerts antinociceptive action in inflammatory pain models.
Cannabinoid Receptor  
Neurological, Eye or Ear Disease  
/
HY-B0246S4 Carbamazepine-d4
Carbamazepine-d4 (CBZ-d4) is the deuterium labeled Carbamazepine (HY-B0246). Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC50 of 131 μM. Carbamazepine blocks voltage gated Na+, Ca2+, and K+ channels, and is also a HDAC inhibitor (IC50: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain.
Isotope-Labeled Compounds  
/
HY-Y0700 Calconcarboxylic acid
Calconcarboxylic acid, an azo dye, acts as a silver-ion sensitizer to stain protein in SDS-PAGE gels. Calconcarboxylic acid increases silver binding on protein bands or spots by the formation of a silver-dye complex and also increases the reducing power o
Fluorescent Dye  
/
HY-W040430 (S)-Nornicotine
(S)-Nornicotine is a nicotine metabolite that crosses the blood-brain barrier. (S)-Nornicotine weakly inhibits human CYP2A6 with a Ki >300 μM. (S)-Nornicotine promotes dopamine release in rat striatal and nucleus accumbens slices and increases endogenous DOPAC overflow through a calcium-dependent nAChR pathway that is sensitive to Mecamylamine (HY-B1395A). (S)-Nornicotine reduces behavioral responses maintained by nicotine or sucrose, exerts analgesic effects in persistent inflammatory pain and neuropathic pain models, and enhances the analgesic effect of morphine. (S)-Nornicotine is useful for research on tobacco dependence and pain.
Drug Metabolite   Cytochrome P450   nAChR  
Pain  
/
HY-90006S2 5-Fluorouracil-15N2
5-Fluorouracil-15N2 is the 15N-labeled 5-Fluorouracil. 5-Fluorouracil (5-FU) is an analogue of uracil and a potent antitumor agent. 5-Fluorouracil affects pyrimidine synthesis by inhibiting thymidylate synthetase thus depleting intracellular dTTP pools. 5-Fluorouracil induces apoptosis and can be used as a chemical sensitizer. 5-Fluorouracil also inhibits HIV.
Exosomes   Nucleoside Antimetabolite/Analog   HIV   Apoptosis   Endogenous Metabolite  
Cancer  
/
HY-N7029 3',​4',​5',​5,​7-​Pentamethoxyflavone
3',4',5',5,7-Pentamethoxyflavone, a natural flavonoid extracted from Rutaceae plants, sensitizes chemoresistant cancer cells to chemotherapeutic agents by inhibition of Nrf2 pathway.
Others  
Cancer  
/
HY-N1479 Polygalic acid
Polygalic acid is a polyphenolic acid with neuroprotective effects, and also an inhibitor of African swine fever virus polymerase (AsfvPolX), with an IC50 value of 5.05 μM. Polygalic acid alleviates neuroinflammation by regulating cholinergic activity, and its fecal level decreases in diseased mice. Polygalic acid can be used in research related to painful diabetic peripheral neuropathy complicated with cognitive impairment and African swine fever.
Cholinesterase (ChE)   DNA/RNA Synthesis  
Neurological, Eye or Ear Disease   Viral Infection   Glucose Metabolism  
/
HY-N2177 3-Dehydrotrametenolic acid
3-​Dehydrotrametenolic acid, isolated from the sclerotium of Poria cocos, is a lactate dehydrogenase (LDH) inhibitor. 3-​Dehydrotrametenolic acid promotes adipocyte differentiation in vitro and acts as an insulin sensitizer in vivo. 3-​Dehydrotrametenolic acid induces apoptosis and has anticancer activity.
Lactate Dehydrogenase   Apoptosis  
Cancer   Digestive System Disease   Digestive System Inflammation  
/
HY-N7152 6-Dehydrogingerdione
6-Dehydrogingerdione sensitizes human hepatoblastoma Hep G2 cells to TRAIL-induced apoptosis via reactive oxygen species-mediated increase of DR5.
Apoptosis  
Cancer   Digestive System Disease   Digestive System Inflammation  
/
HY-50938 D149 Dye
D149 Dye is an indoline-based dye, which is a high-extinction-coefficient metal-free organic sensitizer.
Fluorescent Dye  
/
HY-A0057S Gabapentin-d4
Gabapentin-d4 is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.
Calcium Channel  
Neurological, Eye or Ear Disease  
/
HY-NP192 Sericin
Sericin is an orally active globular protein produced by silkworm cocoons. Sericin inhibits the expression of COX2, iNOS, TLR4, MAPK and NF-κB; reduces the levels of IL-18, IL-1 and CCL2; antagonizes the activity of AChE; and downregulates the expression of Bcl-2. Sericin enhances the PI3K/AKT-mediated insulin signaling pathway. Sericin inhibits the activity of tyrosinase (Tyrosinase), scavenges ROS, chelates metal ions, and increases the levels of antioxidant enzymes. Sericin induces apoptosis and arrests the cell cycle. Sericin exhibits antibacterial, moisturizing, cardioprotective and anticoagulant properties. Sericin can be used in research related to type 2 diabetes, hyperlipidemia, obesity, Alzheimer's disease, colon cancer, peripheral nerve injury and ischemic myocardial infarction.
Reactive Oxygen Species (ROS)   Bacterial   COX   NO Synthase   Toll-like Receptor (TLR)   p38 MAPK   NF-κB   Interleukin Related   Cholinesterase (ChE)   Bcl-2 Family   Tyrosinase   PI3K   Akt  
Cancer   Infection   Neurological, Eye or Ear Disease   Inflammation or Immune System Disease   Metabolic or Endocrine Disease  
/
HY-P10557 DAG peptide
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation.
Biochemical Assay Reagents  
Neurological, Eye or Ear Disease  
/
HY-W035133 5,10,15,20-Tetrakis(p-tolyl)porphyrin
5,10,15,20-Tetrakis(p-tolyl)porphyrin (TTP) is an organic compound belonging to the class of porphyrins, a cyclic molecule composed of four pyrrole rings linked together. TTP is a synthetic porphyrin commonly used as a sensitizer for dye-sensitized solar cells and a catalyst for organic reactions. Due to its unique structure, TTP has a series of interesting properties, including at specific wavelengths and its potential as a catalyst for various chemical reactions. In dye-sensitized solar cells, TTPs help convert sunlight into electricity by absorbing photons and transferring electrons to the semiconductor layer of the device. In organic chemistry, TTP is often used as a catalyst for various organic compounds in reactions such as oxidation and reduction. Its ability to selectively bind certain substrates makes it a useful tool for synthesizing complex molecules and studying their properties.
MOFs  
/
HY-10863S Anandamide-d8
Anandamide-d8 is a deuterated labeled Anandamide. Anandamide is an endocannabinoid. Anandamide modulates both neuronal and immune functions through two protein-coupled cannabinoid receptors (CB1 and CB2). Anandamide can activate numerous other receptors like PPARS, TRPV1, and GPR18/GPR55. Anandamide also has potential anti-fungal and anti-inflammatory activities. Anandamide can be used for the research of Alzheimer’s disease (AD) and ulcerative colitis.
Isotope-Labeled Compounds   Cannabinoid Receptor   PPAR   Endogenous Metabolite   Tau Protein   GPR55   Fungal   TRP Channel  
Infection  
/
HY-N1847 3'-Methoxydaidzein
3'-Methoxydaidzein is a isoflavone and a Sodium Channel inhibitor. 3'-Methoxydaidzein inhibits subtypes NaV1.7, NaV1.8 and NaV1.3 with IC50 of 181 nM, 397 nM, and 505 nM, respectively. 3'-Methoxydaidzein exerts analgesic activity by inhibiting voltage-gated sodium channels.
Sodium Channel  
Neurological, Eye or Ear Disease  
/
HY-B0673S Pirfenidone-d5
Pirfenidone-d5 (AMR69-d5) is a deuterium labeled Pirfenidone. Pirfenidone is an antifibrotic agent that attenuates CCL2 and CCL12 production in fibrocyte cells. Pirfenidone has growth-inhibitory effect and reduces TGF-β2 protein levels in human glioma cell lines. Pirfenidone also has anti-inflammatory activities.
TGF-beta/Smad   CCR  
Cancer   Inflammation or Immune System Disease  
/
HY-90006S 5-Fluorouracil-d1
5-Fluorouracil-d is the deuterium labeled 5-Fluorouracil. 5-Fluorouracil (5-FU) is an analogue of uracil and a potent antitumor agent. 5-Fluorouracil affects pyrimidine synthesis by inhibiting thymidylate synthetase thus depleting intracellular dTTP pools. 5-Fluorouracil induces apoptosis and can be used as a chemical sensitizer. 5-Fluorouracil also inhibits HIV.
Exosomes   Isotope-Labeled Compounds   Nucleoside Antimetabolite/Analog   HIV   Apoptosis   Endogenous Metabolite  
Cancer  
/
HY-W008951 Ethylenediaminetetra(methylenephosphonic acid)
Ethylenediaminetetramethylenephosphonic acid (EDTMP) is a bone-targeted chelating agent. Ethylenediaminetetramethylenephosphonic acid sodium‘s phosphonic acid groups possess a unique ability to bind with high affinity to hydroxyapatite in bone, and can form radioactive compounds with 153Sm and 177Lu. Ethylenediaminetetramethylenephosphonic acid is used to study palliative therapy for pain associated with multiple bone metastatic cancers.
Radionuclide-Drug Conjugates (RDCs)  
Pain   Multiple Myeloma  
/
HY-B0563S1 Ropivacaine-d7
Ropivacaine-d7 is deuterium labeled Ropivacaine. Ropivacain is a potent?sodium channel?blocker. Ropivacain blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is used for the research of neuropathic pain?management.
Isotope-Labeled Compounds   Sodium Channel   Potassium Channel  
Neurological, Eye or Ear Disease   Blood or Cardio-cerebrovascular Disease  
/
HY-P991734 VHB937
VHB937 is a potent and selective TREM2 agonist, a human monoclonal antibody, with sub-nanomolar affinity. VHB937 enhances TREM2 surface expression and downstream signaling, such as Syk phosphorylation and calcium mobilization. VHB937 exhibits robust neuroprotective effects in vivo, significantly reducing pathology and pro-inflammatory markers across a broad range of animal models of neuroinflammation and neurodegeneration. VHB937 can be used for neurodegenerative diseases research.

Species: Human

TREM receptor   Syk   Calcium Channel  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P990781 Suciraslimab
Suciraslimab (SM03) is an anti-human CD22 monoclonal antibody. Suciraslimab inhibits NLRP3 and ASC signaling. Suciraslimab suppresses cytokine (IL-1β, IL-12, IL-23) secretion and α4 integrin expression. Suciraslimab improves working memory and neuroinflammation. Suciraslimab isotype control product: Human IgG1 kappa, Isotype Control (HY-P99001).

Species: Human

CD22   NOD-like Receptor (NLR)   Interleukin Related   Integrin  
Neurological, Eye or Ear Disease   Inflammation or Immune System Disease  
/
HY-P991193 NGM-438
NGM-438 is a humanized monoclonal antibody antagonist of LAIR1, with a Ka of 0.26 nM for human LAIR1 and 4.28 nM for cynomolgus monkey LAIR1. NGM-438 blocks the binding of LAIR1 to its Collagen ligand and antagonizes the Collagen-induced LAIR1 signaling pathway. NGM-438 reverses FcγR signaling inhibition in myeloid cells, induces dendritic cells to secrete TNFα, promotes T cell proliferation, and triggers myeloid inflammation and allogeneic T cell responses. NGM-438 sensitizes refractory mouse lung cancer to PD-1 blockade, increases the content of intratumoral CD8+ T cells and the expression of inflammatory genes. NGM-438 is applicable to research related to solid tumors, refractory solid tumors and non-small cell lung cancer.

Species: Human

TNF Receptor  
Non-Small Cell Lung Cancer  
/
HY-P99149 Anti-Mouse TNFR2 Antibody (TR75-54.7)
Anti-Mouse TNFR2 Antibody (TR75-54.7) is an anti-mouse TNFR2 IgG monoclonal antibody. Anti-Mouse TNFR2 Antibody (TR75-54.7) can reduce white blood cell count (WBC) and decrease the expression of some pro-inflammatory cytokines such as CCL2 and CXCL5. Anti-Mouse TNFR2 Antibody (TR75-54.7) can be used for researches on inflammation conditions and cancer such as breast cancer.

Species: Mouse

TNF Receptor  
Cancer   Inflammation or Immune System Disease  
/
HY-P99781 Plozalizumab
Plozalizumab (MLN-1202) is a humanized anti-CCR2 IgG1 monoclonal antibody. Plozalizumab blocks the recruitment of myeloid cells to the tumor microenvironment by inhibiting the CCL2/CCR2 axis. In addition, Plozalizumab also ameliorates synovial inflammation in rheumatoid arthritis. Plozalizumab can be used in the research of malignant melanoma and bone metastasis-related cancers. Recommended isotype control: Human IgG1 kappa, Isotype Control (HY-P99001).

Species: Human

CCR  
Cancer   Inflammation or Immune System Disease  
/
HY-14536A Methylene blue (purity≥70%)
Methylene blue (purity≥70%) is a guanylyl cyclase (sGC), monoamine oxidase A (MAO-A) and NO synthase (NOS) inhibitor. Methylene blue (purity≥70%) is a vasopressor and is often used as a dye in several medical procedures. Methylene blue (purity≥70%) through the nitric oxide syntase/guanylate cyclase signalling pathway to reduce prepulse inhibition. Methylene blue (purity≥70%) is a REDOX cycling compound and able to cross the blood-brain barrier. Methylene blue (purity≥70%) is a Tau aggregation inhibitor. Methylene blue reduces cerebral edema, attenuated microglial activation and reduced neuroinflammation.
Environmental Pollutants   Microtubule/Tubulin   Guanylate Cyclase   Monoamine Oxidase   NO Synthase  
Cancer   Infection   Neurological, Eye or Ear Disease  
/
HY-N0728S3 α-Linolenic acid-13C18
α-Linolenic acid-13C18 is the 13C labeled α-Linolenic acid. α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
Isotope-Labeled Compounds   PI3K   Akt  
Cancer   Blood or Cardio-cerebrovascular Disease  
/
HY-B1804 Tricaprilin
Tricaprilin (Trioctanoin) is an orally active and well tolerated ketogenic agent that safely induces ketosis. Tricaprilin restores brain electrical activity and metabolism to help counteract neuroinflammation in migraine. Tricaprilin is promising for research of migraine prevention and Alzheimer’s disease (AD). Tricaprilin is a pure C8 medium chain triglyceride (MCT).
Endogenous Metabolite  
Inflammation or Immune System Disease   Alzheimer's Disease  
/
HY-128741 D-Allose
D-Allose exhibits antitumor activity against various cancer cells. D-Allose scavenges reactive oxygen species (ROS) and reduces oxidative stress damage. D-Allose exhibits anti-inflammatory and neuroprotective through inhibition of TLR4/PI3K/AKT signaling pathway. D-Allose exhibits antihypertensive, cryoprotective, and anti-osteoporotic activities.
Endogenous Metabolite   Reactive Oxygen Species (ROS)   Apoptosis   Toll-like Receptor (TLR)   PI3K   Akt  
Lung Cancer   Breast Cancer   Colorectal Cancer   Prostate Cancer   Gastric Cancer   Liver Cancer   Leukemia/Lymphoma/Myeloma   Pancreatic Cancer   Ovarian Cancer   Pain   Digestive System Inflammation   Parkinson's Disease   Hypertension   Obesity   Lung Fibrosis   Rheumatoid Arthritis  
/
HY-P99304 Lumretuzumab
Lumretuzumab (Anti-Human ERBB3 Recombinant Antibody) is a humanized anti-HER3 (ERBB3) monoclonal antibody. Lumretuzumab effectively inhibits the activity of key oncogenic signaling pathways such as PI3K/AKT and MAPK. Lumretuzumab has been optimized through glycosyl engineering to enhance antibody-dependent cell-mediated cytotoxicity (ADCC). Lumretuzumab can be used to study HER3-positive, HER2-low-expressing solid tumors, especially breast cancer.

Species: Human

EGFR   PI3K   Akt   p38 MAPK  
Breast Cancer  
/
HY-P10227 Xelafaslatide
Xelafaslatide (ONL-1204) is a Fas receptor antagonist. Xelafaslatide blocks the Fas receptor signaling pathway and inhibits downstream apoptosis and inflammatory pathways. Xelafaslatide suppresses neuroinflammation and microglial activation in glaucoma models, protects retinal ganglion cells and prevents axonal degeneration. Xelafaslatide is applicable to relevant research on glaucoma.
Fatty Acid Synthase (FASN)   Apoptosis   Interleukin Related   Toll-like Receptor (TLR)   NOD-like Receptor (NLR)   Caspase  
Glaucoma  
/
HY-W250978A Ovalbumin, low endotoxin
Ovalbumin, low endotoxin are the major proteins in egg white. Ovalbumin, low endotoxin act as an allergen and inducer, and can be applied to mouse models of allergic diseases. Ovalbumin, low endotoxin can induce allergic rhinitis in mice via sensitization and nasal challenge. Ovalbumin, low endotoxin can be used to establish asthma models.
Interleukin Related   IFNAR  
Inflammation or Immune System Disease  
/
HY-P991049 Atrosimab
Atrosimab is an Fv-Fc1K fusion protein with an EC50 value of 0.37 nM against humans. Atrosimab inhibits TNF-induced TNFR1 activation, release of IL-6 and IL-8, and cell death, and alleviates neuroinflammation. Atrosimab is applicable to research related to inflammatory diseases, neurodegenerative diseases, acute and chronic inflammation, experimental arthritis, non-alcoholic steatohepatitis, and experimental autoimmune encephalomyelitis.

Species: Human

TNF Receptor  
Experimental Autoimmune Encephalomyelitis   Experimental Autoimmune Encephalomyelitis   Fatty Liver Disease  
/
HY-126358 Acetylcarnitine
Acetylcarnitine is a CNS-penetrant endogenous metabolite. Acetylcarnitine shuttling links mitochondrial metabolism to histone acetylation and lipogenesis. Acetylcarnitine attenuates oxidative stress and neuroinflammation. Acetylcarnitine can be used for fatigue-associated diseases research. Acetylcarnitine can be used as a candidate diagnostic and prognostic biomarker of hepatocellular carcinoma.
Endogenous Metabolite   Mitochondrial Metabolism  
Cancer   Neurological, Eye or Ear Disease   Metabolic or Endocrine Disease  
/
HY-110252 Salvinorin B
Salvinorin B is a selective and brain-penetrant kappa opioid receptor (KOPr) agonist with an EC50 of 248 nM and Ki of 2.95 μM. Salvinorin B activates downstream signaling pathways by binding to KOPr, inhibits pain transmission and reduces inflammatory response. Salvinorin B can be used for the researches of inflammation, immunology and neurological disease, such as neuropathic pain, multiple sclerosis and anxiety.
Opioid Receptor  
Inflammation or Immune System Disease   Depression   Pain  
/
HY-W021005 Silver bis(trifluoromethanesulfonyl)imide
Silver bis(trifluoromethanesulfonyl)imide is a kind of silver salt and is widely used as an organic synthesis catalyst. Silver bis(trifluoromethanesulfonyl)imide is used for the C-3 regioselective alkylation of indole derivatives with α,β -enones through conjugated addition reactions. Silver bis(trifluoromethanesulfonyl)imide can also be used as a highly efficient and stable solid-state dye sensitization and P-type dopant for perovskite solar cells.
Biochemical Assay Reagents  
/
HY-100355 C18-Ceramide (d18:1/18:0)
C18-Ceramide (d18:1/18:0) is a bioactive molecule with multiple functions in cells, not a traditional agonist or inhibitor targeting a single site. It can act on multiple cellular targets, such as proteins related to endoplasmic reticulum stress (e.g., ATF-4, XBP-1, CHOP), proteins in the PI3K/AKT signaling pathway, and SNARE complex proteins. It exerts activities like inducing cell death, promoting autophagy, and regulating exocytosis through mechanisms such as activating endoplasmic reticulum stress, inhibiting the PI3K/AKT signaling pathway, and affecting lipid raft - related functions. It can be used in research on the mechanism of neuronal injury in the field of neuroscience and in the treatment research of cancers such as glioma in the field of oncology.
Endogenous Metabolite  
Cancer   Neurological, Eye or Ear Disease  
/
HY-P78765 USAG-1 Protein, Human (HEK293, Fc)
USAG-1 protein is involved in initiating endometrial receptivity, contributing to implantation preparation and decidual cell response sensitization. It regulates signaling pathways by enhancing Wnt signaling while inhibiting TGF-β signaling. USAG-1 Protein, Human (HEK293, Fc) is the recombinant human-derived USAG-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Species: Human; Source: HEK293

/
HY-P78488 MCP-1/CCL2 Protein, Human (HEK293, His-Avi)
MCP-1/CCL2 Protein, Human (HEK293, His-Avi) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein MCP-1/CCL2 Protein, Human (HEK293, His-Avi) is a recombinant human MCP-1/CCL2 (Q24-T99) expressed by HEK293 with His and Avi tags at the C-terminus.

Species: Human; Source: HEK293

Cytokines and Growth Factors Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P72757 MCP-1/CCL2 Protein, Mouse (HEK293, His)
MCP-1/CCL2 Protein, Mouse (HEK293, His) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293, His) is a mouse MCP-1/CCL2 expressed by HEK293 with a His tag at the C-terminus.

Species: Mouse; Source: HEK293

Cytokines and Growth Factors Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P700164AF Animal-Free MCP-1/CCL2 Protein, Mouse (His)
The MCP-1/CCL2 protein, as a CCR2 ligand, induces potent chemotactic responses and intracellular calcium mobilization in monocytes and basophils, without affecting neutrophils or eosinophils.It is critical for neuropathic pain and enhances NMDA-mediated synaptic transmission in neurons containing dopamine D1 and D2 receptors, possibly involving MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation.Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Species: Mouse; Source: E. coli

Cytokines and Growth Factors Animal-free Recombinant Proteins Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P700231AF Animal-Free MCP-1/CCL2 Protein, Pig (His)
MCP-1/CCL2 protein acts as a ligand for CCR2, inducing chemotactic responses and calcium mobilization. It attracts monocytes and basophils but not neutrophils or eosinophils. Animal-Free MCP-1/CCL2 Protein, Pig (His) is the recombinant pig-derived animal-Free MCP-1/CCL2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Species: Pig; Source: E. coli

Cytokines and Growth Factors Animal-free Recombinant Proteins Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P77589 CCR2b Protein-VLP, Human (HEK293)
CCR2b Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Species: Human; Source: HEK293

Cytokines and Growth Factors CD Antigens Receptor Proteins Chemokine & Receptors T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins G-Protein-Coupled Receptors (GPCRs) Cytokine Receptors CC Chemokine Receptor Chemokine Receptor CCR2/CD192

/
HY-P77590 CCR2b Protein-VLP, Human (Biotinylated, HEK293)
CCR2b Protein-VLP, Human (Biotinylated, HEK293) is recommended only for SPR analysis. HY-P77589 can be used in animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Species: Human; Source: HEK293

Cytokines and Growth Factors CD Antigens Receptor Proteins Biotinylated Proteins Chemokine & Receptors T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins G-Protein-Coupled Receptors (GPCRs) Cytokine Receptors CC Chemokine Receptor Chemokine Receptor CCR2/CD192

/
HY-P74758 MCP-1/CCL2 Protein, Mouse (sf9, His)
MCP-1/CCL2 Protein, Mouse (sf9, His) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (sf9, His) is a mouse MCP-1/CCL2 expressed by  Spodoptera frugiferda(Sf9) with a His tag at the C-terminus.

Species: Mouse; Source: Sf9 insect cells

Cytokines and Growth Factors Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P76489 MCP-1/CCL2 Protein, Mouse (Biotinylated, sf9, His)
MCP-1/CCL2 Protein, Mouse (Biotinylated, sf9, His) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (Biotinylated, sf9, His) is a biotinylated mouse MCP-1/CCL2 (M1-N148) expressed by  Spodoptera frugiferda(Sf9) with a His tag at the C-terminus.

Species: Mouse; Source: Sf9 insect cells

Cytokines and Growth Factors Biotinylated Proteins Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P700787 MCP-1/CCL2 Protein, Cynomolgus (HEK293, His)
MCP-1/CCL2 protein activates CCR2 and induces chemotaxis and calcium ion mobilization. It attracts monocytes and basophils, not neutrophils or eosinophils. It also contributes to neuropathic pain and enhances synaptic transmission in dopamine neurons. MCP-1/CCL2 exists as a monomer or homodimer and binds to endothelial cells through proteoglycans. It interacts with TNFAIP6 via its Link domain. MCP-1/CCL2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MCP-1/CCL2 protein, expressed by HEK293 , with C-His labeled tag.

Species: Cynomolgus; Source: HEK293

Cytokines and Growth Factors Chemokine & Receptors CC Chemokines MCP-1/CCL2

/
HY-P705530 TRPV1 Protein, Human (Cell-Free, His)
TRPV1 protein is a core pathway for temperature and pain perception in mammals. Activation of TRPV1 protein primarily mediates extracellular calcium ion influx, triggering sensory neuron depolarization, action potential firing, and neurogenic inflammation. TRPV1 protein is widely involved in physiological and pathological processes such as pain perception, thermoregulation, osmolarity regulation, coughing, and overactive bladder. TRPV1 protein, Human (Cell-Free, His) is a recombinant TRPV1 protein with a N-10*His tag.

Species: Human; Source: E. coli Cell-free

Receptor Proteins

/
HY-P79350 USAG-1 Protein, Mouse (HEK293, His)
The USAG1 protein emerges as a potential modulator in the complex process of endometrial receptivity and sensitization of implanted decidual cells. By enhancing Wnt signaling and inhibiting TGF-β signaling, USAG1 plays a regulatory role in key molecular pathways during these reproductive events. USAG-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived USAG1 protein, expressed by HEK293 , with C-10*His tag.

Species: Mouse; Source: HEK293

/
HY-P81171 MCP1 Antibody
MCP1 Antibody is a Rabbit-derived and non-conjugated IgG polyclonal antibody, targeting to MCP1.

Host: Rabbit; Reactivity: Human, Rat

Polyclonal Antibodies Flow Cytometry Antibodies Primary Antibodies

/
HY-P87121 TRPV1 Antibody (YA6814)
TRPV1 Antibody (YA6814) is a Mouse-derived and non-conjugated IgG1 monoclonal antibody, targeting to TRPV1.

Host: Mouse; Reactivity: Rat

Monoclonal Antibodies Recombinant Antibodies Primary Antibodies

/
HY-P87536 CCR-2 Antibody (YA7220)
CCR-2 Antibody (YA7220) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to CCR-2.

Host: Rabbit; Reactivity: Human

Monoclonal Antibodies Recombinant Antibodies Flow Cytometry Antibodies Primary Antibodies

/
HY-P811643 TRPV1 Antibody (YA10118)
TRPV1 Antibody (YA10118) is a Rabbit-derived and non-conjugated IgG recombinant monoclonal antibody, targeting to TRPV1.

Host: Rabbit; Reactivity: Mouse, Rat

/
HY-P811644 TRPV1 Antibody
TRPV1 Antibody is a Rabbit-derived and non-conjugated IgG polyclonal antibody, targeting to TRPV1.

Host: Rabbit; Reactivity: Mouse

Polyclonal Antibodies Primary Antibodies

/
HY-P84311 CCR2 Antibody (YA4008)
CCR2 Antibody (YA4008) is a Mouse-derived and non-conjugated IgG1 monoclonal antibody, targeting to CCR2.

Host: Mouse; Reactivity: Human

Monoclonal Antibodies Flow Cytometry Antibodies Primary Antibodies

/
HY-P84311A CCR2 Antibody (YA4008)(PBS only)
CCR2 Antibody (YA4008) is a Mouse-derived and non-conjugated IgG1 monoclonal antibody, targeting to CCR2.

Host: Mouse; Reactivity: Human

Monoclonal Antibodies Primary Antibodies

/

Keywords

CCL2 | CCR2 | peripheral pain sensitization | dorsal root ganglion | nociceptor sensitization | inflammatory pain | neuropathic pain | neuroinflammation | Nav1.8 | TRPV1 | PI3K/Akt signaling | Gβγ signaling | chemotherapy-induced peripheral neuropathy | bone cancer pain | neuroimmune signaling